ISPye35

  • Family IS630
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP020442 ND Paracoccus yeei
Paracoccus yeei
Paracoccus yeei FDAARGOS_252
DNA section
IS Length : 1056 bp

Ends


IR Length : 9/11

IRL : GAGCGTGTCGCGGGCATCGAGATTCAGGATTCCCAGCTTGCCTATGATGT
IRR : GAGCCTGTTGCACTCAATCGGCCTCATAACCTGCGGCTTTGAAGTAGTTG

Insertion site


Left flankDirect repeatRight flankDR Length
cagtgacgatTAaaatagctct2

DNA sequence

GAGCGTGTCGCGGGCATCGAGATTCAGGATTCCCAGCTTGCCTATGATGTGCTTCCCTTCTGCTGAGGCAGGTATGGGGGGGCTGATGGGCAAGCCACAT
CCAATGGAGCTTCGGACGCGGGTCGTCGCCTATGTGGACGAAGGCCACGGACATCGCGAGGCGGCCCGGCACTTTCGAGTTTCGCCCAAATTCGTCAACG
ATCTGGTGAAGCTGCGACGCGAGACCGGGTTGTTGACGCCCAAGCGGCAAGGCAATGGCGGCGGATACGGGAAGCTGGCAGGCGTAACCGATTGGCTCAA
GGCGCGTGTCACCAAAAAGGGCGAGATCACGCTCAACGAATTGGTGGTCGAACTGGACAGAACCCATGGCATCGCCGTGCACCGTGCCAGCGTTTGGCGC
GTTCTGCGGGGGCTCGGACTGACACACAAAAAAAGCCCTGCAGGCGCTTGAACAGAAGCGAAAGGACGTAGCCGCTCTGCGCCATGTCTGGATCGCGAGA
CGCCAGCCCTTCATAGCCAACCATCTGGAGCGCCTGGCGTTCGTTGACGAAACCGGGGTCAAGACGAACATGGCCAAGACCACAGGATGGGCGCCCTGTG
GGCAGCGCCTCGTCGATCATGCGCCGTTCGGGCATTGGCGCACCCAGACCTTTGTCGCCGCCCTGCGCCATGACCGGCTGGACGCGCCTTGGGTGATCGA
TGGCGCAATGAACGCCGAGATGTTTGATCTCTACACCAAAACCCAGTTGGTCCCGACACTCCGGCCCCGTGACGTCGTCATTCTGGACAATCTTTCCAGC
CACAAGAGCCCTGCCGCGGCGGCAGCACTGCGCGATGTCGGCGCGTGGTTCCTGTTCCTGCCGCCTTACAGTCCTGACCTCAACCCGATCGAAATGGCTT
TCGCCAAGCTCAAGGCGCTGATCAGAAAAGCTGCCGCACGAACCTACGATCAACTATGGGCTGCGGTCGGCCAGGTCTGCGATCTGTTCTCCGACGAGGA
ATGCTACAACTACTTCAAAGCCGCAGGTTATGAGGCCGATTGAGTGCAACAGGCTC
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
378 bp125 aa74451+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MGGLMGKPHPMELRTRVVAYVDEGHGHREAARHFRVSPKFVNDLVKLRRETGLLTPKRQGNGGGYGKLAGVTDWLKARVTKKGEITLNELVVELDRTHGI
AVHRASVWRVLRGLGLTHKKSPAGA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
621 bp206 aa4231043+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

HTKKALQALEQKRKDVAALRHVWIARRQPFIANHLERLAFVDETGVKTNMAKTTGWAPCGQRLVDHAPFGHWRTQTFVAALRHDRLDAPWVIDGAMNAEM
FDLYTKTQLVPTLRPRDVVILDNLSSHKSPAAAAALRDVGAWFLFLPPYSPDLNPIEMAFAKLKALIRKAAARTYDQLWAAVGQVCDLFSDEECYNYFKA
AGYEAD

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
970 bp322 aa741043+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MGGLMGKPHPMELRTRVVAYVDEGHGHREAARHFRVSPKFVNDLVKLRRETGLLTPKRQGNGGGYGKLAGVTDWLKARVTKKGEITLNELVVELDRTHGI
AVHRASVWRVLRGLGLTHKKALQALEQKRKDVAALRHVWIARRQPFIANHLERLAFVDETGVKTNMAKTTGWAPCGQRLVDHAPFGHWRTQTFVAALRHD
RLDAPWVIDGAMNAEMFDLYTKTQLVPTLRPRDVVILDNLSSHKSPAAAAALRDVGAWFLFLPPYSPDLNPIEMAFAKLKALIRKAAARTYDQLWAAVGQ
VCDLFSDEECYNYFKAAGYEAD

 

Blast result :
Comments
ISPye35 is 62% aa similar to ISSpo6.
ISPye35 was identified by in silico sequence analysis of Paracoccus yeei strain FDAARGOS_252. The third ORF is the putative ORFAB transposase reconstructed in silico by possible frameshift.
References
1] Chmielowska C., Szuplewska M., Bartosik D. (2018) Direct submission.
2] Goldberg,B., Campos,J., Tallon,L., Sadzewicz,L., Sengamalay,N., Ott,S., Godinez,A., Nagaraj,S., Vavikolanu,K., Aluvathingal,J., Nadendla,S. and Sichtig,H. (2017) Direct GenBank submission.