ISPye38

  • Family IS5
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP024425 ND Paracoccus yeei
Paracoccus yeei
Paracoccus yeei CCUG 32053
Paracoccus yeei TT13
DNA section
IS Length : 1366 bp

Ends


IR Length : 18

IRL : CAGGCCGCTGAAATAGTCCTGCCTCGACAGTGGTTTGAGAACATGATTCA
IRR : CAGGCCGCTGAAATAGTCGCCGGGCCGGAACGGTTTCCCTTGGTTGCCGG

Comments : Insertion in an entrapment vector pMEC1 enabled precisely defining ends and DRs.

Insertion site


Left flankDirect repeatRight flankDR Length
gaagcgggccTTAAagtgcgccta4
cagccaaggcTTA/cA/Tcatgatcgca4
TTATAAGCATTTAACATCAATGCA4
GCACGTCGCCTTAAAGCAATTTAT4

DNA sequence

CAGGCCGCTGAAATAGTCCTGCCTCGACAGTGGTTTGAGAACATGATTCACCGTCGGCATGATAACGGCGGGGGTTATGATGCGCGGGACGGACGAGGCG
AGCGGGTCGCTGTTCAGCTATGTGGACCTGGAGGCGCGCATCCCCGCGCGGCATCCGTTGCGCAAGATCCGGCAGGTGGTGAACGACGCGCTGGCCAGCC
TGGATGGCGAGTTCGAGGCGCTTTACACCGATTTCGGCCGCCCCTCGATCCCGCCGGAACGGCTAATCCGGGCGAGCCTGATCCAGATCCTGTTCTCGGT
CCGCTCCGAGCGGCAGTTGATGGAACAGATGCAGTATAACCTCTTGTTCCGCTGGTTCGTCGGCCTCGGGATTGACGACGCCGTCTGGGTGCCGACCGTC
TTCACCAAGAACCGCGACCGGCTACTGACCACCGGGATGTCGCGCAAGGTGATGGCAGCGATCCTGGCCCATCGCGAGGTCGCGCCGCTCTTGTCGGACG
ACCACTTCTCGGTCGATGGCACACTGGTGAAGGCCTGGGCCTCCATGAAGAGCTTCCAGCCGAAGGCGACCGACACGCCGTCTGACGACGATCCGGGCGG
CCCGCCCGGTCCAGACAGCCCCACCGAAGACCACCCTGAGCCGACACCGTCCGAGACCGACCCGATGTCCCGCCCCACCCACCAGAACCGCAATGCCGAA
GTCGATTTCCGGGGCCAGAAGCGCTCCAATGCCACCCATGCCTCGACGACCGACCCCGACGCGCGGCTCTACAAGAAATCCCCCGGCACCGGCGCGATGC
TGTGCTTCATCGGGCATGCGCTGATGGAGAACCGGAATGGGCTCATCGTGCAGGGCGACCTTACGCAGGCCGACGGTCACGCGGAACGGCGTGCCGCACT
GGACATGATCCACCGCCATTCACCCGGCTCGACCCGACAGTTGACGCTCGGCGCCGACAAGGGGTTCGACGCGGCAGAGTTCGTCGCCGACCTGCGAAAA
GCCTGCATAACACCCCATATCGCGCAGAAATCGAGATATTCAGCGATCGACGGCCGCACCACCCGGCACGAGGGTTACTCCCTGTCGATCAAACACCGCA
AACGGATCGAAGAGGCATTTGGCTGGGCCAAAACCGTCGGTGGCATGGCCCAGACCGTCTATCGGGGCATCGAACGGGTGCGTTCCCGCTTCATCCTGAC
GATGACTGCCAACAACCTCGCGCGACTGCCTCGGCTGTTGGCCGCATGATGACGAAAAACCGCGTCAGTCACACACACGCGTTTCAGAACAAAAAGCGCG
CGGCCGGGCAGCAAAGCCGGCAACCAAGGGAAACCGTTCCGGCCCGGCGACTATTTCAGCGGCCTG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1173 bp390 aa771249+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MMRGTDEASGSLFSYVDLEARIPARHPLRKIRQVVNDALASLDGEFEALYTDFGRPSIPPERLIRASLIQILFSVRSERQLMEQMQYNLLFRWFVGLGID
DAVWVPTVFTKNRDRLLTTGMSRKVMAAILAHREVAPLLSDDHFSVDGTLVKAWASMKSFQPKATDTPSDDDPGGPPGPDSPTEDHPEPTPSETDPMSRP
THQNRNAEVDFRGQKRSNATHASTTDPDARLYKKSPGTGAMLCFIGHALMENRNGLIVQGDLTQADGHAERRAALDMIHRHSPGSTRQLTLGADKGFDAA
EFVADLRKACITPHIAQKSRYSAIDGRTTRHEGYSLSIKHRKRIEEAFGWAKTVGGMAQTVYRGIERVRSRFILTMTANNLARLPRLLAA

 

Blast result :
Comments
ISPye38 is 91% aa similar to ISRosp6.
ISPye38 was identified by in silico sequence analysis of Paracoccus yeei strains: CCUG 32053 (1 copy) and TT13 (1 copy, reconstructed). Additionally, ISPye38 has been identified by its transposition into an entrapment vector pMEC1 (cI-tetA) in P. yeei CCUG 32053.
References
1] Chmielowska C., Szuplewska M., Bartosik D. (2018) Direct submission.
2] Lim, J. Y., Hwang, I., Ganzorig, M., Pokhriyal, S., Singh, R., & Lee, K. (2018). Complete Genome Sequence of Paracoccus yeei TT13, Isolated from Human Skin. Genome Announcements, 6(3), e01514–17.