ISLmo9

  • Family IS3
  • Group IS150
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP006611 ND Listeria monocytogenes
Listeria monocytogenes
Listeria monocytogenes N1-011A
DNA section
IS Length : 1473 bp

Ends


IR Length : 25/34

IRL : TGAATCTCTACCCGAAAAATGAACACTCAAAAAAAAGAGTGTTGTTAGTT
IRR : TGAACCCCTACCAATAAACTGAACAAATAAAAAAGAACATTATACTGCCC

Insertion site


Left flankDirect repeatRight flankDR Length
ataaacgccttaattggatt0

DNA sequence

TGAATCTCTACCCGAAAAATGAACACTCAAAAAAAAGAGTGTTGTTAGTTTTCGGTATACTTTATTTGAGTTATACAGAAGGGAGTGGGCATTTTGAGTA
AAAAGATTTATAACCAATCTGAAATTAAAAATTTGGAAAATAATCCGAATATCAAAAGTGTGACAGAGAGAAGCATCACCTATTCATCAGAATTCAAAAC
AAAGGCAATTAAACAGAGCCTACAAGGCATGACGGCCACTCAGATATTTGAACTTGCAGGACTTCCTTTCCGTTTAATTGGAGAAGGAAAAGCGAACCAA
TCACTGTCTCGTTGGAAAAAATTATATAAAAGACATGGCGAAGATATATTGCTTCAAGAGACTTGTGGTACTGGTCAGAGTGGTCCATATGGATCAAGAG
GACAACTATCGTTAGAAGAAGCTTTAGAAAAAGCTAATGCCCGTATAGCCTATTTGGAGGGTAATCTTGAACTAGTAAAAAAATTAGAATTGCACGAGAG
GAGCGTGAAAAACGACAGAAAAAACGACTTAACTAAACAGGAACGCTTTGAATTAATTAACCAAATTATTCGTGAAAATCAACTTGTTGGCATGGTTAAT
CATTTGTGTAATCTTGCGGGGGTAAGTAGAAGTGGCTATTATTACTGGCTAAGTAGTAGCTATAAACGAAATGAATGTGAGCGCAATGATTGGGAAGATT
TCCAATTGTTATATAGGGTATTTCTCGATAAGAAGAAATGTGGCATCGATGAAATAAAAATGGCGCTAGAAAATGAATACAGTATAATAATGAATCATAA
AAAAATCAGAAGAATTATGCGTAAAAATGCCATTATATCAACAATAAGAGCAGCTAAACCGTATCGTAAAATCATGAAGGCAACTCAAGAAAATGCTACG
AAGAAAAATATTCTCAATCGCCAATTTAATCATAATATGCCATATAAAGTGTTTCTAACAGATATCACTTATCTTCCTTATGGAAGTGGACAATGGGCTT
ATCTTTCAGCTGTTAAAGATGGTTCTACTGGCGAGATTGTTGCACACCACTTCTCAACTAGCTTAAAAATGAACTTAGTTTATGAAACACTGGATAAATT
GAATGATGTGATTAAAGATATGCCATTAATGGACAGATATATCCACTCAGATCAAGGTATTCATTATACATATCCTGTTTTCCAGGAAAAAGTAAAAGAT
ATCGGGTTAATTCAATCCATGTCGAGGCGGGGGAACTGTTGGGATAATGCACCAATAGAATCATTTTTCGGACATATGAAGGATGTAGTATTATCCGAAA
GAAGAGAAACACTACAAGACCTTTGGTATGCTGTCGAAGAGTATATTGAATTTTACAACAATCATCGTTATCAGAAAAAATTAAAAAAGATGACCCCGAC
TGCTTATCGGGATCATCTTCTGTGGGCAGTATAATGTTCTTTTTTATTTGTTCAGTTTATTGGTAGGGGTTCA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1341 bp446 aa941434+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

LSKKIYNQSEIKNLENNPNIKSVTERSITYSSEFKTKAIKQSLQGMTATQIFELAGLPFRLIGEGKANQSLSRWKKLYKRHGEDILLQETCGTGQSGPYG
SRGQLSLEEALEKANARIAYLEGNLELVKKLELHERSVKNDRKNDLTKQERFELINQIIRENQLVGMVNHLCNLAGVSRSGYYYWLSSSYKRNECERNDW
EDFQLLYRVFLDKKKCGIDEIKMALENEYSIIMNHKKIRRIMRKNAIISTIRAAKPYRKIMKATQENATKKNILNRQFNHNMPYKVFLTDITYLPYGSGQ
WAYLSAVKDGSTGEIVAHHFSTSLKMNLVYETLDKLNDVIKDMPLMDRYIHSDQGIHYTYPVFQEKVKDIGLIQSMSRRGNCWDNAPIESFFGHMKDVVL
SERRETLQDLWYAVEEYIEFYNNHRYQKKLKKMTPTAYRDHLLWAV

 

Blast result :
Comments
ISLmo9 is 63% aa similar to ISBsp3.
ISLmo9 was identified by in silico sequence analysis of Listeria monocytogenes strain N1-011A plasmid. ISLmo9 is present in many plasmids of L. monocytogenes strains.
References
1] Chmielowska, C. and Bartosik, D. (2018) Direct submission.