ISPye46

  • Family IS110
  • Group IS1111
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP024422 ND Paracoccus yeei
Paracoccus yeei
Paracoccus yeei CCUG 32053
Paracoccus yeei strain TT13
DNA section
IS Length : 1361 bp

Ends


IR Length : 11/12

IRL : ATGATGTGACCGCCCCCCCGACGGCTTCGCTGTGCCAGGGTGGGTCTGGG
IRR : TGTGTAACCGCCCCAAGCGCAAGGGGGATCTTCGGAGCTGATGTTGGCGC

Comments : Inserted within the IR of another IS (similar to ISSpo9). IRs are not at the termini of the IS.

Insertion site


Left flankDirect repeatRight flankDR Length
gcaggggctcTGttgcacaaaa2

DNA sequence

ATGATGTGACCGCCCCCCCGACGGCTTCGCTGTGCCAGGGTGGGTCTGGGACGATCCACAGAGGGGAGAGGTCATGTCGGAGATTACCACGATCGGGCTC
GATCTTGCGAAGCATGTGTTTCAGCTTCACGGGGCCGACGCTTCTGGGCGAGCGGTGCTGCGCAAGAAGCTTCGGCGGGACCAGGTGCTGGCGTTCTTCA
GCCAGCTACCATCCTGCGTCGTCGTGATGGAGGCGTGCGGTGGCGCCCATTTCTGGGGTCGTGAGATCGGGAAGCTGGGCCATGAGGTGCGGCTCATCCC
GCCGGCCTATGTGAAGCCTTTTGTGAAGCGCCAGAAGAACGATGTCGGCGATGCGGAAGCGATCTGTGAAGCGGCGCTGCGCCCGACGATGCGCTTCGTG
CCGGTGAAGAGCGAGGAGACCCAAGGGGCGGCGATGGTCTTCCGGGTGCGCGAGCTTCTGATCCGGCAGCGCACGCAGGCGATCAATGCCCTGCGCGGTC
ACTTGGCCGAGTTCGGGCAGATCGTGCCCCAGGGTGCGGCCAACGCCGCGCGGCTGATCGCGATCGTCGAGAACCAGGACAGCGACCTGCCAGCAGACGC
CATCGCCACGCTGAAGGTGCTGGTCGCGGCGCTCATCCACCTCGAGACGGAGATCGCCAGGCTCGATGCCGAGATCGCCCGTCGCGCCAAGGAGGACGAG
GTGGCCCGGCGGCTGATGACGGTGCCCGGCATCGGTCCGCTGATCGCCACGGCCCTCGCGGTCCTGGCCCCGCCACCCGGAACGTTCCGCAAGGCTCGGG
ACTTTGCGGCCTGGCTCGGCCTCACGCCGCGGCAGCATTCGACCGGCGGCAAGCAGCGGCTCGGGGCCACGACGAAGATGGGCGAACGCTCCCTCAGGCG
ATTGCTGATCCTCGGCGCCAACAGCGTCATCATCAAGCGGCATGTCCATGCCGCAGCCCGGCCAGGCACCTGGCTGGGCGGGATGCTGACCCGCAAGCCA
CCGATGCTGGTGCGGGTGGCGCTGGCGAACAAGATGGCGCGGATCGTCTGGGCCCTGATGGCCAAGGGCGGCGTCTACCAGTCTCCGGCCGCAGCGGCGT
AAGCCGTCTGTCGGTCGCGAGGACGTCGGAGCGGAGGAGGGCAAGGAGCAGTTTGGCGCAACGGTCGTGAGACGGGATCGGGAGACCCAGGGTGCAACAG
AGTGCCATCGAGCACGCGGCTTTGATCTGGACCCGACCCGCGGACACCATACGGGCCCGCGGCATGACGATGGCCGCATCAGAGGCCGGACACATGTCGG
CACCCGACACCGCGCCAACATCAGCTCCGAAGATCCCCCTTGCGCTTGGGGCGGTTACACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1029 bp342 aa741102+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MSEITTIGLDLAKHVFQLHGADASGRAVLRKKLRRDQVLAFFSQLPSCVVVMEACGGAHFWGREIGKLGHEVRLIPPAYVKPFVKRQKNDVGDAEAICEA
ALRPTMRFVPVKSEETQGAAMVFRVRELLIRQRTQAINALRGHLAEFGQIVPQGAANAARLIAIVENQDSDLPADAIATLKVLVAALIHLETEIARLDAE
IARRAKEDEVARRLMTVPGIGPLIATALAVLAPPPGTFRKARDFAAWLGLTPRQHSTGGKQRLGATTKMGERSLRRLLILGANSVIIKRHVHAAARPGTW
LGGMLTRKPPMLVRVALANKMARIVWALMAKGGVYQSPAAAA

 

Blast result :
Comments
ISPye46 is 96% aa similar to ISPye21.
ISPye46 was identified by in silico sequence analysis of Paracoccus yeei strains: CCUG 32053 (1 copy) and TT13 (1 copy). Very similar to ISPye21, but seems to have 4bp longer nucleotide ends.
Inserted within the IRL of another IS (IS5 family). Very similar to ISPye21.
References
1] Chmielowska C., Szuplewska M., Bartosik D. (2018) Direct submission.
2] Lim, J. Y., Hwang, I., Ganzorig, M., Pokhriyal, S., Singh, R., & Lee, K. (2018). Complete Genome Sequence of Paracoccus yeei TT13, Isolated from Human Skin. Genome Announcements, 6(3), e01514–17.