ISD1

  • Family IS3
  • Group IS407
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AF034211 Y Desulfovibrio vulgaris
Desulfovibrio desulfuricans Norway
Desulfovibrio vulgaris Hildenborough
DNA section
IS Length : 1 bp

Ends


IR Length : 31/40

IRL : TGTAGCCCTCCCCTAGAATAGGTCCATTGAAAAATAGAGATTTCTGATCA
IRR : TGTAAACCTCCCCAAGTTAGTGCCATCCAAAAGTAGAGACTTCCTTGGGT

Insertion site


Left flankDirect repeatRight flankDR Length
TTAATTGTCCTTGTTCAAGGATCTGTCTTTGACAACAG4
TTATTTGTTAACTGTTAATTGTCCTTGTTCAAGGATGC4

DNA sequence

TGTAGCCCTCCCCTAGAATAGGTCCATTGAAAAATAGAGATTTCTGATCAAGATTGCCTCATGGAGTGCAAAATGAAGAAATCTCGATTTTCTGAAAGCC
AAATCATCAGGATTTTGAAAGAAGCCGATGGCGGTCGCAAGGTCGTTGATATCTGCCGTGAAAACGGCGTGAGCCAAGCCACCTACTACCAGTGGAAGGC
CAAGTTCGGCGGCATGGAAGCTTCGGATATCCGCAGGCTCAAGGAACTTGAAGAAGAGAACAGCAAGCTCAAGCGCATGTTCGCCAATCTCAGCCTCGAG
AACGAGGCCTTGAAGGACGTCATTGCAAAAAAGCTTTGAGGCCAGCCGAGAAGCGCGATTTGGCGGATTTCATACACAGCGAGCATGGTCTCAGTGAGCG
GCGGTCATGCGCTGCGCTGGGGCTTAGCCGGACAGTGTACCGGTATGAGCTCAAACCGAGAGATGATTCGCTGATCATTGAAGCGCTCCTGGGGCTGGCC
GACAGGTATCCTCGTTACGGTTTCGGTAAGCTGTTCGCGGTATTGCGCCGACACGGTTTTCGCTGGAACCATAAACGCGTCTACCGGGTATATTGTCTTT
TAAAGATGAACCTTCGGCGCAAAGGCAAGAAGCGCCTGCCCTCGCGAAACCCGCAACCACTGGCGGTTCCGCCATGCGCAAATGTCTGCTGGTCCATTGA
CTTCATGCATGACGCATTGGCTAGTGGTCAAAGGTTTAGGACGTTCAATGTGTTGGACGACTTCAGCCGTGAGTGTTTGGCTATCGAAGTTGATACGAAT
TTGCCAGCGGCACGAGTCTTGCGAGTTTTGGACCGAATAGTGGCTTGGCGCGGGCTGCCTGCCAAATTGAGAATGGATAACGGGCCGGAGCTGATTTCGG
TGCTGCTGGCCGACTGGGCCGAGAAGAACGGCGTGGCATTGGAGTTCATCCAGCCAGGCAAGCCCACACAGAATTCGTACATTGAGCGGTTCAACAAGAC
CTATCGGGAAGAGGTTCTGGACTTCTATCTGTTCAAATCCCTTACAGAAGTGAAGGAAATTACGGAGAACTGGCTGCGGCAGTACAACGAGGAACGACCC
CATGAGTCTCTTGGCGATTTGACCCCGGCAGAGTTCCTCCTGAAAAATTCACCCAAGGAAGTCTCTACTTTTGGATGGCACTAACTTGGGGAGGTTTACA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
267 bp88 aa77343+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MKKSRFSESQIIRILKEADGGRKVVDICRENGVSQATYYQWKAKFGGMEASDIRRLKELEEENSKLKRMFANLSLENEALKDVIAKKL

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
932 bp310 aa2561187+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

RREQQAQAHVRQSQPRERGLEGRHCKKALRPAEKRDLADFIHSEHGLSERRSCAALGLSRTVYRYELKPRDDSLIIEALLGLADRYPRYGFGKLFAVLRR
HGFRWNHKRVYRVYCLLKMNLRRKGKKRLPSRNPQPLAVPPCANVCWSIDFMHDALASGQRFRTFNVLDDFSRECLAIEVDTNLPAARVLRVLDRIVAWR
GLPAKLRMDNGPELISVLLADWAEKNGVALEFIQPGKPTQNSYIERFNKTYREEVLDFYLFKSLTEVKEITENWLRQYNEERPHESLGDLTPAEFLLKNS
PKEVSTFGWH

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1111 bp370 aa771187+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKKSRFSESQIIRILKEADGGRKVVDICRENGVSQATYYQWKAKFGGMEASDIRRLKELEEENSKLKRMFANLSLENEALKDVIAKKALRPAEKRDLADF
IHSEHGLSERRSCAALGLSRTVYRYELKPRDDSLIIEALLGLADRYPRYGFGKLFAVLRRHGFRWNHKRVYRVYCLLKMNLRRKGKKRLPSRNPQPLAVP
PCANVCWSIDFMHDALASGQRFRTFNVLDDFSRECLAIEVDTNLPAARVLRVLDRIVAWRGLPAKLRMDNGPELISVLLADWAEKNGVALEFIQPGKPTQ
NSYIERFNKTYREEVLDFYLFKSLTEVKEITENWLRQYNEERPHESLGDLTPAEFLLKNSPKEVSTFGWH

 

Blast result :
Comments
Frameshift motif A6G (nt331-337) stem-loop (nt345-370)
References
1] Fu, R. and Voordouw, G. (1998) Appl. Environ. Microbiol. 1, 53-61.