ISPye56

  • Family IS5
  • Group IS903
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP024422 ND Paracoccus yeei
Paracoccus yeei
Paracoccus yeei TT13
DNA section
IS Length : 1053 bp

Ends


IR Length : 18

IRL : GGCGTTGTTGCAGAACTCGTCCCAGCGAGGATTCACGCGGGGGCTGCTGT
IRR : GGCGTTGTTGCAGAACTCACCTTTTGAGGTGAGTTCCCCTTACCCCACCA

Comments : Empty insertion site in P. yeei FDAARGOS_252 enabled precisely defining ends.

Insertion site


Left flankDirect repeatRight flankDR Length
cgcgacggcgGGTTCGAGCcgtccgtcag9
ccggagcaacgatctgacca0
aacattgacgCCGGAATAGaccccatgtc9
cgcggtattgCAACGGATCgccgatgcct9
gggttcaaacggtccattct0
gcacctgctcggtgatgccg0
agcatgcccgcctctgcatc0

DNA sequence

GGCGTTGTTGCAGAACTCGTCCCAGCGAGGATTCACGCGGGGGCTGCTGTAGGTTAAGCGTCCTTGCATGACGAAGCCTGAACCTGCCCGTTACCGCACG
ACGAACTGGAAATCCTACAACGCTGCCCTGAGGCGGCGCGGCTCGCTGCTGATCTGGTTGGACAGGGATATGGCATGGCTGGCGAGCGGGGCCGGGCGTC
CCGGCCGCCCGCCGGTGTTCTCCGATGCAGCGATCCAGTTCTGCCTGATGGTGAAGGTGCTCTTTGGCCTGCCGCTTCGGCAAACCACCGGCATGGTGGC
CAGCATCCTGGAGATGGCAGGGCTGGATTGGCCGGTGCCGGACTTTTCCACGCTGAGCCGCAGACAGAAGACTCTTGCCGTTCAGATATCCAACCGCCGC
GCGCCAGGGCCGCTGAACTTGTTGGTGGACAGCACCGGGATCAAGTTTCTGGGCGATGGAGAGTGGCTGGCGCGCAAGCACGGCACGCACCGCAGGCGCC
AATACCGCAAGGTCCATCTGGCGATGGACACGGCTACCGGTGACATCCGGGCGGTGGAGTTCACCTCAAGTCGTGAGGGAGACAGCCCTGTCCTGCCGGG
CCTTCTGGATCAGATCCCGCCCGCCGAACAGATCGGCACCGTGACCGGCGACGGCGCCTTCGACACCCGGCGGTGTCACACGGCCATCCTGGATCGCGGC
GGCACCGCCGTTATCCCGATCCGCAGGAACGGTCGCTTGTGGAAGGAAGACTGCCCTGCCGCCCGCGCCCGCAACGACATCCTTCGGGCGACCAGGCGCT
TTGGGCGAGCCAACTGGAAGCACTGGTCCGGGTATCACGCCCGAAGCAGGATCGAGGCAAGAATGCGCTGCCTCAAATCATTCGGCGAGCGGATCGCCTC
ACGAGACCCGGACAGACAAACCGCCGAGGTCCACATCCGCATCGCACTCATGAACCGCTTCAACGCACTCGGCACCGCCGAGATCAAGCGCGTGGCATGA
GGTTGGTGGGGTAAGGGGAACTCACCTCAAAAGGTGAGTTCTGCAACAACGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
933 bp310 aa681000+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MTKPEPARYRTTNWKSYNAALRRRGSLLIWLDRDMAWLASGAGRPGRPPVFSDAAIQFCLMVKVLFGLPLRQTTGMVASILEMAGLDWPVPDFSTLSRRQ
KTLAVQISNRRAPGPLNLLVDSTGIKFLGDGEWLARKHGTHRRRQYRKVHLAMDTATGDIRAVEFTSSREGDSPVLPGLLDQIPPAEQIGTVTGDGAFDT
RRCHTAILDRGGTAVIPIRRNGRLWKEDCPAARARNDILRATRRFGRANWKHWSGYHARSRIEARMRCLKSFGERIASRDPDRQTAEVHIRIALMNRFNA
LGTAEIKRVA

 

Blast result :
Comments
ISPye56 is 95% aa similar to ISPth1.
ISPye56 was identified by in silico sequence analysis of Paracoccus yeei strain TT13 (7 copies present in the genome).
References
1] Chmielowska C., Szuplewska M., Bartosik D. (2018) Direct submission.
2] Lim, J. Y., Hwang, I., Ganzorig, M., Pokhriyal, S., Singh, R., & Lee, K. (2018). Complete Genome Sequence of Paracoccus yeei TT13, Isolated from Human Skin. Genome Announcements, 6(3), e01514–17.