ISHsal3

  • Family IS4
  • Group ISH8
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Halobacterium salinarum
Halobacterium salinarum DSM 3754
DNA section
IS Length : 1403 bp

Ends


IR Length : 17/18

IRL : CATCCGTCTTTAGCTAAGACGAGAACCGCGTGACAGCGACGGCTTATCGA
IRR : CATCCGTCTTTAGTTAAGCTTCACACCTCGGTTGTGTAGCGGTAACGAGC

Insertion site


Left flankDirect repeatRight flankDR Length
TCCCGCCTGAATACCCTCTATACG0

DNA sequence

CATCCGTCTTTAGCTAAGACGAGAACCGCGTGACAGCGACGGCTTATCGAGGCTACTTTTCGAGAGGAATGAGGAGGAGAAGTCTGTGCACAACCCTCGC
TCCTCAACGAGAATCATGCGTCGGCTCACTACACTGTTTCCCTCTGAGTTCCTCGAAGAACACGCCGAGGAACTCGGCGTGGTCGAACGTGACCGCAAGC
TCCAGATCCCTGCCTTCGTTTGGGCGTTCGTGTTCGGCTTCGCCGCAGGCGAACGCCGAACACTCGCCGGGTTTAGACGCTGTTACAACTCTACTGCCGA
TGAAACGATCTCTCCGGGTGGATTCTATCAGCGGTTGACACCGACGCTTGCGGAGTACCTCCGCGACCTCGTCGAGGCCGCGCTCGACGAGGTCGCTGTT
CCTAACGCTGTTGACGCTGATCTCGACCGATTTAGAGACGTGATGATCGCTGATGGAACGGTGTTGCGGTTACACGAATTTCTCTCAGATCAGTTCGAAG
CCCGCCACGAGGAGCAGGCTGGAGCGAACCTCCACCTGCTCCACAATGCCACCGAGCAGACGATTGAACGGCTCGATACTGCTAACGAGAAAACGCACGA
CAGCACCTTGTTCAACACGGGGCCGTGGCTTGAGAATCGCCTCGTGTTGTTCGATCTCGCGTACTTCAAGTACCGCCGGTTTGCGCTGATCGACGAGAAC
GGCGGCTCCTTCGTGAGTCGGCTGAAGCAGAACGCGAATCCGCTGATTACGGGGGAGTTACGGGAATGGCGCGGTCGCGCCATTCCCTTAGAGGGCAAGC
AGCTCAGAGCTGTTCTCGACGATCTCGATCGGACGTACATCGATGTAGAAGTCGAAGTCGAATTCAAACGAGGGCCGTACAATGGGATGCGGTCACTAGA
TACGAAGCGATTTCGCGTCGTCGGCGTCCGCGACGAGGACGCCGACGACTACCACCTGTACATGACGAATTTAGCGAGGAAGGAGTTCTTTCCGGCGGAT
TTAGCGGAGATCTATCGCTGTCGGTGGGAAGTTGAGTTGCTGTTCCGGGAGCTGAAGACGCAGTACGAATTGGACGAGTTCGACACGAGTGACGAACACG
TGGTGAGGATCTTATTGTACGCAGCGCTGCTGTCGCTGCTTGTGAGCCGTGATCTGTTGGATTTAGTCACCGAGCAGGCGGATGATGAGCTTGTGTTTCC
GACGGAGCGCTGGGCGGCGACCTTTCGGTCGCACGCCCAGCTCATTCTCCACGAACTCGGTGAGTTCCTCGGCTATTCACCACCGCCGCTGCTCGACCGG
CTGATCGAAGACGCTCAAAAGATCCACAAGCAACGACCAATCTTACAAGAGACGCTCGTTACCGCTACACAACCGAGGTGTGAAGCTTAACTAAAGACGG
ATG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1275 bp424 aa1161390+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRRLTTLFPSEFLEEHAEELGVVERDRKLQIPAFVWAFVFGFAAGERRTLAGFRRCYNSTADETISPGGFYQRLTPTLAEYLRDLVEAALDEVAVPNAVD
ADLDRFRDVMIADGTVLRLHEFLSDQFEARHEEQAGANLHLLHNATEQTIERLDTANEKTHDSTLFNTGPWLENRLVLFDLAYFKYRRFALIDENGGSFV
SRLKQNANPLITGELREWRGRAIPLEGKQLRAVLDDLDRTYIDVEVEVEFKRGPYNGMRSLDTKRFRVVGVRDEDADDYHLYMTNLARKEFFPADLAEIY
RCRWEVELLFRELKTQYELDEFDTSDEHVVRILLYAALLSLLVSRDLLDLVTEQADDELVFPTERWAATFRSHAQLILHELGEFLGYSPPPLLDRLIEDA
QKIHKQRPILQETLVTATQPRCEA

 

Blast result :
Comments
ISHsal3 is 97% aa similar to ISH8A.
References
1] Pfeiffer F., Marchfelder A., Habermann BH., Dyall-Smith M. (2018) Direct submission.