ISHsal9

  • Family IS630
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Halobacterium salinarum
Halobacterium salinarum DSM 3754
DNA section
IS Length : 1056 bp

Ends


IR Length : 18/26

IRL : TAGTAACCGGTAGAACTTTTCACTCAGAGATAGTTGCAGTAGCTAGTGAA
IRR : TAGTAGACGTTAGAAGTAATTGCTCACTTTTGGAACGGAGAGCTGGTTGA

Insertion site


Left flankDirect repeatRight flankDR Length
AACTTCAACAGCTAGCCAATCCACAC2

DNA sequence

TAGTAACCGGTAGAACTTTTCACTCAGAGATAGTTGCAGTAGCTAGTGAATCATCTCGACGAGATCATCGTCGAGGAATTGCAAGACGCTCTCGACAACG
TGGACGGAAAGAAGCCGACAAAACGGCTCTTAGCGGCAATCGCGTACAAGAATTGTGTAACGCAGACCGAGCTAGCCGAGTGGTACGACGTGCAGCGACG
GACCATCTACAGCTGGCTCAAGCGACTCGACACTGACGAGTCGCTTGAGCAAGCCGTGTCTGACGATAAACGAACTGGGAGAAAGCGTAAACTCTCAGAA
TCACAGCAGGAAGCATTCGAAGAAACCGTTCACGATCCACCTGAAGAGGTCGGGATTGACGCGCCGGCGTGGACGCCGGCGCTTGCTCAAGAGTATCTCG
AAGAAACATACGGCGCTGAGTATTCAATCCCGAGTTGTCGGCGATTGCTGAAAGAAGCGGGATTGAGCTATCAAAAACCACGCCGTTCAGCCGCCGAAGC
CGACGAAGATGACCACAAAGAATTCCACGACGAGCTCAAAAAAAAGCGGCGGGAAATGGACGCCACCGTAGTCTGTATCGATCAAACCAAGAAATCCGTG
CAAGTTGAGCCGCGTGCCGCGTGGTTTCCGCGCGGCACGCGGCCCTCGGTCGAGCTTTCAGGCCAACGTGATTGGACGTGTCTGCTGGGCGCGATCACCG
AGGACGGTGATCGCTTCTTCTCTCGGTTCACCGAGTACGTCACGGCCGAACACGCAAAACATTTCATTTTAGCATTATGTGAAGAATTCGAAGATGACTT
GATCGTCGTGTTGGACGGAGCGCCGTATTTTCAGGCGTCGGCGGTCACGGACCTGGCGGCCCGTGACGACCTCGCCTTCGTGACGTTACCCTCGTATTCA
CCGGAGTTGAATCCGGTCGAAGAATGCTGGAGACAGCTGCAAGCCGCGCTGAGCAACCGCTTCTTTGACTCACTCGACGAGCTAACGACCGCAATCGATA
CCGCTCTCAACCAGCTCTCCGTTCCAAAAGTGAGCAATTACTTCTAACGTCTACTA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1002 bp333 aa461047+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNHLDEIIVEELQDALDNVDGKKPTKRLLAAIAYKNCVTQTELAEWYDVQRRTIYSWLKRLDTDESLEQAVSDDKRTGRKRKLSESQQEAFEETVHDPPE
EVGIDAPAWTPALAQEYLEETYGAEYSIPSCRRLLKEAGLSYQKPRRSAAEADEDDHKEFHDELKKKRREMDATVVCIDQTKKSVQVEPRAAWFPRGTRP
SVELSGQRDWTCLLGAITEDGDRFFSRFTEYVTAEHAKHFILALCEEFEDDLIVVLDGAPYFQASAVTDLAARDDLAFVTLPSYSPELNPVEECWRQLQA
ALSNRFFDSLDELTTAIDTALNQLSVPKVSNYF

 

Blast result :
Comments
ISHsal9 is 96% aa similar to ISHvo16.
References
1] Pfeiffer F., Marchfelder A., Habermann BH., Dyall-Smith M. (2018) Direct submission.