ISHsal10

  • Family IS630
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Halobacterium salinarum
Halobacterium salinarum DSM 3754
DNA section
IS Length : 1055 bp

Ends


IR Length : 19/26

IRL : TAGTAACCGGTAGAACTTTTTACTCAGAGATAGTTGCAATAGCTAATGAA
IRR : TAGTAAACACTAGAAGTAATTGCTCACGTTAGGAACAGAGAGTTTGTCGA

Insertion site


Left flankDirect repeatRight flankDR Length
CCTCTGATATCCTAGGATACTGATCT2

DNA sequence

TAGTAACCGGTAGAACTTTTTACTCAGAGATAGTTGCAATAGCTAATGAATCATCTCGACGAGATCACCGTCGAGGAATTGCAAGACGCTCTCGACAACG
TGGACGGAAAGAAGCCGACACAACGGCTCTTAGCGGTAATCGCGTACAAGAATGGTGTCACGCAGACCGAGCTAGCCGAGTGGTACGACGTGCAGCGACG
GACAATCTACAGCTGGCTCAAGCGACTCGACACTGACGAGTCGCTTGAGCAAGCCGTTTCTGATGATAAACGAACTGGGAGAAAGCGTAAACTCTCAGAA
TCACAGCAGAAAGAATTCGAAGAAACCGTTCACGACCCACCGAGCGAGGTCGGGATCGACGCGCCGGCGTGGACGCCGGCGCTTGCTCAAGAGTATCTCG
AAGAAACATACGGCGCTGAGTATTCAATCCCGAGTTGTCGGCGGTTGCTGAAAGAAGCGGGATTGAGCTATCAAAAACCACGCTGTTCAGCCGCCGAAGC
CGATGAAGACGAGCAAGAAGCGTTCCACGACGAGCTCAAAAAAAGCGGCGGGAAATGGACGCCACCGTAGTCTGTATCGGCCAAACCAAGAAATCCGTCC
AAGTTGAGCCGCGTGCCGCGTGGTTTCCACAGGGCACGCGGCCCTCGGTCGAGCTTTCAGGCCAACGTGATTGGACGTGTCTACTGGGCGCGATCACCGA
GGACGGTGATCGCTTCTTCTCTCGGTTCACCGAGTACGTCACGGCCGAACACGCAAAGCATTTCATTTTAGCATTATGTGATGAATTCGAAGATGATTTG
ATCGTCGTGTTGGACGGAGCCCCGTATTTTCAGGCGTCGGCCGTCACGGACCTGGCAGCCCGTGACGACCTCGCCTTCGTGACGTTACCCTCGTATTCAC
CGGAGATGAATCCGGTCGAAGAATGCTGGAGACAGCTGCAAAAGGCACTAAGCAACCGATTCTTTGACTCACTCGACGAGCTAACAACAGCGATCGACAC
CGCTCTCGACAAACTCTCTGTTCCTAACGTGAGCAATTACTTCTAGTGTTTACTA
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
525 bp174 aa46570+Yes
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MNHLDEITVEELQDALDNVDGKKPTQRLLAVIAYKNGVTQTELAEWYDVQRRTIYSWLKRLDTDESLEQAVSDDKRTGRKRKLSESQQKEFEETVHDPPS
EVGIDAPAWTPALAQEYLEETYGAEYSIPSCRRLLKEAGLSYQKPRCSAAEADEDEQEAFHDELKKSGGKWTPP

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
540 bp179 aa5071046+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

RRARSVPRRAQKKRREMDATVVCIGQTKKSVQVEPRAAWFPQGTRPSVELSGQRDWTCLLGAITEDGDRFFSRFTEYVTAEHAKHFILALCDEFEDDLIV
VLDGAPYFQASAVTDLAARDDLAFVTLPSYSPEMNPVEECWRQLQKALSNRFFDSLDELTTAIDTALDKLSVPNVSNYF

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1001 bp333 aa461046+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNHLDEITVEELQDALDNVDGKKPTQRLLAVIAYKNGVTQTELAEWYDVQRRTIYSWLKRLDTDESLEQAVSDDKRTGRKRKLSESQQKEFEETVHDPPS
EVGIDAPAWTPALAQEYLEETYGAEYSIPSCRRLLKEAGLSYQKPRCSAAEADEDEQEAFHDELKKKRREMDATVVCIGQTKKSVQVEPRAAWFPQGTRP
SVELSGQRDWTCLLGAITEDGDRFFSRFTEYVTAEHAKHFILALCDEFEDDLIVVLDGAPYFQASAVTDLAARDDLAFVTLPSYSPEMNPVEECWRQLQK
ALSNRFFDSLDELTTAIDTALDKLSVPNVSNYF

 

Blast result :
Comments
ISHsal10 is 96% aa similar to ISHvo16.
The third ORF is the putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Pfeiffer F., Marchfelder A., Habermann BH., Dyall-Smith M. (2018) Direct submission.