ISDra5

  • Family IS5
  • Group IS1031
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AE000513 ND Deinococcus radiodurans
Deinococcus radiodurans
Deinococcus radiodurans plasmid pCP
DNA section
IS Length : 911 bp

Ends


IR Length : 17/19

IRL : TAGAGCCTGTCAGTCTAGCAATCTGACTTTTTATAAAAAATATGTAAATA
IRR : TAGAGGCTGTCAGGCTAGCGAGCCAAGAATTGGCTTTAATTTGTTTAGGA

Insertion site


Left flankDirect repeatRight flankDR Length
CTCGCCGGTTGGCTGAAGGTCT2

DNA sequence

TAGAGCCTGTCAGTCTAGCAATCTGACTTTTTATAAAAAATATGTAAATAGCATAGTAAGGGTGTCACGGCTGGGTGTAGAACTGGGACATGCTGTCAGA
GCGAAAACCCTACAAGAGCGACCTGGATGACGAAACTTACCTCTTCATCCTGCCTTACTTTCTGCTCGCTCCAGAAGACGCTCACCAGCGCGTCTACCCG
ATACGTGAAGTCCTCAATGCCGCTCTGTGGATTGGCCGCACAGGGAGTCAGTGGGAGTACCTCCCACACGACTTTCCGCCATACAAAATTGTCCATCAGC
AACTGATGCGGTGGTTTGAACGAGGTTGCTTCGAGAACCTCGCTCACGACCTGCATTCACTGGTTCGCGAGGACGCCCTCAAGGAGGGCGTTCCTACCGT
TGCCATCGTGGATAGCCGCACTCTGCAAAGCACGCCCGAGAGTGGCGGACGTGCTGGATATGACGGTGGAAAGCGTCGTAAGGGCAGCAAAATCCACGCT
GCTGTCGACACGATGGGTAATGTCATGACGTTGCTCGTCACCCCTGGCAATGAGCAAGACCGAGAACAGGTCTATGACTTGTGCCGCGAGGTGCAGCAGG
TCACTGGTGACCACATTGATGTCGTTATCGCCGACCAGGGGTACACCGGAGAGCAGCCGCAGATTGATGCTTCCTTGAACGATGTGGAACTTGTTGTGGT
GAAACGCCCGACTGGAGCGACGGGCTTTGTGCTGCTTCCGTTGCGATGGGTGGTTGAACGGACATTCGCCTGGACAGCACGTTTTCGCCGTCTATCACGT
GATTTGGAGAGGCTGCAAAGCAGTCTCCTCGGCTTTCACTGGCTCGCGGTATCTGTTACGCTCCTAAACAAATTAAAGCCAATTCTTGGCTCGCTAGCCT
GACAGCCTCTA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
813 bp270 aa90902+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLSERKPYKSDLDDETYLFILPYFLLAPEDAHQRVYPIREVLNAALWIGRTGSQWEYLPHDFPPYKIVHQQLMRWFERGCFENLAHDLHSLVREDALKEG
VPTVAIVDSRTLQSTPESGGRAGYDGGKRRKGSKIHAAVDTMGNVMTLLVTPGNEQDREQVYDLCREVQQVTGDHIDVVIADQGYTGEQPQIDASLNDVE
LVVVKRPTGATGFVLLPLRWVVERTFAWTARFRRLSRDLERLQSSLLGFHWLAVSVTLLNKLKPILGSLA

 

Blast result :
Comments
There are 2 copies of ISDra5 in Deinococcus radiodurans genome, one on chromosome1 and one on plasmid CP.
References
1] White,O., Eisen,J.A., Heidelberg,J.F., Hickey,E.K., Peterson,J.D., Dodson,R.J., Haft,D.H., Gwinn,M.L., Nelson,W.C., Richardson,D.L., Moffat,K.S., Qin,H., Jiang,L., Pamphile,W., Crosby,M., Shen,M., Vamathevan,J.J., Lam,P., McDonald,L., Utterback,T., Zalewski,C., Makarova,K.S., Aravind,L., Daly,M.J., Minton,K.W., Fleischmann,R.D., Ketchum,K.A., Nelson,K.E., Salzberg,S., Smith,H.O., Venter,J.C. and Fraser,C.M. (1999) GenBank Direct Submission