ISHsal13

  • Family IS200/IS605
  • Group IS605
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Halobacterium salinarum
Halobacterium salinarum DSM 3754
DNA section
IS Length : 1701 bp

Ends


Left end : AGCGGTAGCGAGGCGAAAGCCCACCCGTTCACGGGTGGGATGAAGCCGACAACTGGGAATCTTTCCACGCTCGTAGGCACGGCTGGGGTTGAATGTCTGC II struct. : Yes
Right end : TCATCGTCCACCGTGACGACGAACCTGCGAACCTCTCCGTATCCGTGGGTTCAACCCCCAGTGGGGGAACCCCACGGCTTTAGCCGTGGGAGGATGTCAG II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
GTTTTCAGCACGTTACTGGATGTAGCTCTCAG

DNA sequence

AGCGGTAGCGAGGCGAAAGCCCACCCGTTCACGGGTGGGATGAAGCCGACAACTGGGAATCTTTCCACGCTCGTAGGCACGGCTGGGGTTGAATGTCTGC
GTAACATCTTTCGGTGAGTGACTTCTACATAGTGACGATGCCTCGTGGGTTCGACAGGGAACGTACCAACGTCCACAAACTCCAGTACCACTTCATCTGG
TGCCCGAAGTACCGCAAATCGGTGCTTGAAGGCGAGGTACGTGACCGTCTCGAAGAACTCATCGAGGAGAAAGCCGACGAACTCGGGTTGGAGATACTGG
AGTTGGCAATTCGCCCCGACCACGTACACCTGTTCATCACAGGCGACCCGACCCTTGCCCCGAACAAGATAATGCAACAGGTCAAGGGCTACTCCTCGCG
CCACCTCCGAGACGAGTTCGACTTCGGCTTGCCGTCGCTGTGGACGCGCTCGTACTTCGTCTCAAGTGCGGGCGACGTATCCAGCGAAGTCATTGAGGAG
TACATCGACGCCCAAGCAGGTGAGTAGTCATGCAACGGAACGTCTCAACCACGGTGCGGGTCAAACTCCACTCGCTGACCAACAAGAAAGCTGACCTGCT
CGCCCGTGAGTACGAGGCGTTCCAGACTGAGGTTCACGGCGGAGACGCCAACCTCTACTCCGCGACCGACCAGCAGGCGTCGAAGGTGCAACGACAGAAA
GACCCGAACCCCGACACCGAACAGCCCGTCGTTCTCCGCAACGACGTGTTGGACGTGTCCTACGACGAGGACACCGTTCTCTCGTCGTGGTGGGTCAAAG
TCCCCGTCTACGACCCCGAACGGGGACGAGGAAACTCCATCTGGTGCCCTGCCCACGTTCCGCACAAAGACGAACAACTCGTCCGCAAGGGTGATATTCG
GGACAGCGAACTGGTGCGCCGTGACGGTGACTGGTACGTCCATCTCGTCGTGAAGCGGTCTGTGACCGTCCAAGACGAGTACGACGACGTGCTGGCTATC
GATATGGGCACACGGTGGGTCGCTACCTGCGCGTTCCTCTCCGACCGCAAAACCACCTTCTACGGCGAGGACGTGCGCCGTATCCGCGAACACTACAAGC
AACTCCGCAAGTCCATCGGGAAATCGAAACCCCGACAGGGACAACAGGTGGTCGAGCGTATCGGTGACGCTGAAACGCGGAAGGTGGACGACCGCCTCCA
CAAAATTGCTCGGCACATCGTGGAGGATGCCGAGGAACGGAACGCAGTCATCGTCGTGGGCGACCTCGGCGGAATTCGCAAGGACAACGACAAGGGACGG
TACGTCAACGACAAGACCCACAAGATGCCGTTCGCCCGCCTGCTCAACTACATCGAATACAAAGCCCACGACGCAGGCATCGACGTGCAGTTGGTCGAAG
AATACGACACGTCGCAGACGTGCAACCGCTGTGCTTGCGAGGGTGTCCGTGAGACGCAGGGACGCTTCGAGTGCCCCGAGTGCGGGTTGGACGACAACGC
GGACAAGAACGGTGCGCTCAACATCGGCAAACGAGCCTTGGGCAAGTTCGAAAGACCGCTGTCCGAGGCGGGGGTCGTACTGGCACGGCCCGAAACGCAG
GTCATCGTCCACCGTGACGACGAACCTGCGAACCTCTCCGTATCCGTGGGTTCAACCCCCAGTGGGGGAACCCCACGGCTTTAGCCGTGGGAGGATGTCA
G
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
390 bp129 aa138527+No
ORF function : Transposase
Chemistry : Y1

ORF sequence :

MPRGFDRERTNVHKLQYHFIWCPKYRKSVLEGEVRDRLEELIEEKADELGLEILELAIRPDHVHLFITGDPTLAPNKIMQQVKGYSSRHLRDEFDFGLPS
LWTRSYFVSSAGDVSSEVIEEYIDAQAGE

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1155 bp384 aa5301684+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MQRNVSTTVRVKLHSLTNKKADLLAREYEAFQTEVHGGDANLYSATDQQASKVQRQKDPNPDTEQPVVLRNDVLDVSYDEDTVLSSWWVKVPVYDPERGR
GNSIWCPAHVPHKDEQLVRKGDIRDSELVRRDGDWYVHLVVKRSVTVQDEYDDVLAIDMGTRWVATCAFLSDRKTTFYGEDVRRIREHYKQLRKSIGKSK
PRQGQQVVERIGDAETRKVDDRLHKIARHIVEDAEERNAVIVVGDLGGIRKDNDKGRYVNDKTHKMPFARLLNYIEYKAHDAGIDVQLVEEYDTSQTCNR
CACEGVRETQGRFECPECGLDDNADKNGALNIGKRALGKFERPLSEAGVVLARPETQVIVHRDDEPANLSVSVGSTPSGGTPRL

 

Blast result :
Comments
ISHsal13 is 100% (transposase) and 97% (TnpB) aa similar to ISHhu3.
In the genome, this element is interrupted by a copy of ISHsal5.
References
1] Pfeiffer F., Marchfelder A., Habermann BH., Dyall-Smith M. (2018) Direct submission.