ISHsal5

  • Family IS200/IS605
  • Group IS1341
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Halobacterium salinarum
Halobacterium salinarum DSM 3754
DNA section
IS Length : 1687 bp

Ends


Left end : ATAATTGTATTTAGGCGCGAAGTTCCCCTCCTCAAGGAGTCGTTCGAGAGAGCAGAGCTCTCTCGTGATCACGAAATCGGGGATTTTCGGGCAACAACGC II struct. : Yes
Right end : GTGGATACACTTGTATCTGCAAAGCACGTCGTAGAAGCAGGAAGCCCCACTAAATGAGCGAACCGTATCAGCGGTGAGCGAGTCGGGTGGGGTAGTTCAC II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
GCGACCAGACTCATAAAACGGGGTACGCTCAC

DNA sequence

TTGTATTTAGGCGCGAAGTTCCCCTCCTCAAGGAGTCGTTCGAGAGAGCAGAGCTCTCTCGTGATCACGAAATCGGGGATTTTCGGGCAACAACGCAGGC
CGTAGGCTGAGTAGCGTTAACAAGAACACGAAGCGTTCTTGAGATGCAGTAGGGCGGGGAAACAGCGCCCCAGAAATCTTCGGTTTCTGGTGTGTGAGCG
ACACGCTTCGCGCCTCGTCTCCTCGACGCCGTCATCGTCTCCTAAACACTCCGCGACGACTGACCCAGGGACCCATGCAATCACAATCCTTATTTGTGTA
GTTTATGTATAATATGTTGTGGCGACTCGCAAGAACATCTCCATCCGTGACGACCAAGAGGAGTGGATTCAGGACAATCACCTGAACCTTTCCTCGTTCG
TCCAAGAGAAACTGGACGAACTCATCGAGGAACGAGAGTCATAGATGCACTACAACTACAAGTATCGACTCGACCCACCGGAAGCTCTCGCGGAGACGCT
TCTGAATCACGTCGATACTTGTAGGCAACTCTACAACCACGTCCTCTATCTGCTCAACGAGGCAGACGACAGTCCAGCCCGCTACGAAGTGCAGGGACGA
CTCCCGGACCTCAAATCGTGGTGGGGCGACCTGCGCGACGTTCACTCGAAAGTATTGCAGATGGTGGTCAAGCGCGTCTACGACAATCTCTCCACGCTGA
AAGCACAGAAGGAGAACGGATGCGCCGTGGGAAACCTCAAGTGGAAACCGCCCCGAGAGTATCGGTCGCTCACCTACAACCAGTTCGGCTTCAAACTCAA
GAATACGAGTGGTCGGCCTGTCCTGTGGTTGAGCAAAATCGGAGAGATACCGATTCACCTCCACCGAGACATTCCCGAGAACGCGACCATCAAACAGGTC
ACGGTCAAGCAAGAACCCACGGGCGACTGGTTCGCCACGTTCGGCATCGACGTGGACGAAGACACTCCCGAGAAACCGGAGAATCCAGAGCGAGTCATCG
GAATTGACGTTGGTATCCTGAAGTACGTACATGATACGGATGGAATCGCTGTCGAGTCACCAGACTTCTCCGACGAGCGCGAACGATTGGAACGTGCCCA
ACGCGAACTTTCGCGGAAGGAACACGGCTCTGCTAATTGGGAGAAACAACGGCAGGTTGTGGCAGAACGCCACGCCGACCTAAAGCGGAAGCGACGAGAC
TTCCTCCACAAGCTCTCGAACTACTACGCCCGCGAGTATGACCTTGTGGCGGTCGAAGACTTGGACGCGAAGGGTTTGGTCGAACTGCCGAGTAACTCAC
GGAATCGAGCAGGTGCGGCGTGGGGAACGTTCCAGCGGATGCTCGAATCCAAGTGCGAACGCGAGGGAACGCACTTCGTCGCGGTTGACCCGAAGGACAC
GACAAAAGAGTGTGCTTCCTGCGGTGTCAAGACGGACAAACCGCTGTGGGTTCGTGAACACTCCTGTCCCGCCTGCGGGTTCGAGGCGGACAGGGACGCG
AACGCAGCGTGGAATATTCTGTCTCGCGGTCTTGAAGACGTAGGAGTGGGTCACTCCGAATCAACGCCTGTGGAGACTGCGCTCCCTGTGGATACACTTG
TATCTGCAAAGCACGTCGTAGAAGCAGGAAGCCCCACTAAATGAGCGAACCGTATCAGCGGTGAGCGAGTCGGGTGGGGTAGTTCAC
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
126 bp41 aa319444+No
ORF function : Passenger Gene
Annotation : conserved hypothetical proteinDescription :

ORF sequence :

MATRKNISIRDDQEEWIQDNHLNLSSFVQEKLDELIEERES

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1197 bp398 aa4451641+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MHYNYKYRLDPPEALAETLLNHVDTCRQLYNHVLYLLNEADDSPARYEVQGRLPDLKSWWGDLRDVHSKVLQMVVKRVYDNLSTLKAQKENGCAVGNLKW
KPPREYRSLTYNQFGFKLKNTSGRPVLWLSKIGEIPIHLHRDIPENATIKQVTVKQEPTGDWFATFGIDVDEDTPEKPENPERVIGIDVGILKYVHDTDG
IAVESPDFSDERERLERAQRELSRKEHGSANWEKQRQVVAERHADLKRKRRDFLHKLSNYYAREYDLVAVEDLDAKGLVELPSNSRNRAGAAWGTFQRML
ESKCEREGTHFVAVDPKDTTKECASCGVKTDKPLWVREHSCPACGFEADRDANAAWNILSRGLEDVGVGHSESTPVETALPVDTLVSAKHVVEAGSPT

 

Blast result :
Comments
ISHsal5 is 94% (TnpB) aa similar to ISNamo25.
In the genome, this element is interrupted by a copy of ISHsal2 and a copy of ISNpe16.
References
1] Pfeiffer F., Marchfelder A., Habermann BH., Dyall-Smith M. (2018) Direct submission.