ISHsal12

  • Family IS200/IS605
  • Group IS1341
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Halobacterium salinarum
Halobacterium salinarum DSM 3754
DNA section
IS Length : 1414 bp

Ends


Left end : TGACACCCACCTAATTCAGCGAGGGAGTCCCCGCCGTTCACGGCAGGCGGGAACCGCGTAAGCTCTGTGCCGCAACCGCAGTACAGTAGCATGGTAACTG II struct. : Yes
Right end : GGGACGCTGAACGGAAACGGCGACTACTCGCCTTCCACAGTATAGTGGACAGACCGGGAGTCAACCGACAAACCTCGCCGTTCACGGCGAGGTAGGTGAT II struct. : Yes

Insertion site


Left flankLE cleavage siteRight flankRE cleavage site
CGTCGCCCCTGGCGGAAGAACAACTGAT

DNA sequence

TGACACCCACCTAATTCAGCGAGGGAGTCCCCGCCGTTCACGGCAGGCGGGAACCGCGTAAGCTCTGTGCCGCAACCGCAGTACAGTAGCATGGTAACTG
CCTGAAATTTATATAATATTGACCCCACATGTGGTATGTAGATGGAGCTTCAGCGTACTGCTGTCGTTAAGCTCTCCGTCCCCAACGAGCGCCAAGACGA
CCTGAAACGGACAATGGATACGTTTCGGGACGCTTCCCAGAGGTTTGCTGATCGGGGATGGCAGGGTGACGACAGTGGCTACGTGATAACGTCGCGCTCT
CGTCTTCAACCACTTGTCTACGACGACATACGGGAAGACACCGGTTTACACTCGGATTTGACTGTGGCCGCCGTCAACCATGCGTCAGACGCTCTCTCCG
GGTGCGTAGACCGGATGAAGGAAGGTGAACGAACCTCGAAACCGGTGTTCACCTCGAATACGACCGTCTACAACACAAACGCGATTACGTACTTTGACGG
CTACTGTTCGTTGGCCGCATACGGAAGTGGTCGTGTTCACGCCGAGTATGTCTACCCGGACGACTCTCTGCAAGCTGAATACATGGAGGGTGACGAGTGG
ACAAAGCAGGGCGCGAAGCTCCGCTACGACTGTCAGTCAGATACCTACTACCTACACGTTTCCGTCAAGCAGGAACGTGAAGATTCGTCGGAAGGAGCCG
AGAGCCGAACAGTTCTCGGCGTGGACCGGAACGTGGACGGGTATCTGGCAGTCACAAGCACAGGCGCGTTCATCGGGAACGCGGACTTGCTGAACCACAA
ACGTCGCGAGTACGAACGTCGCCGCAACCGCCTACAACAGACAGGCACACGGAACGCACATCTTACAATTCAGTCCATCGGGGATACTTTTGCCAACTGG
TCTGAAGACTTCTTGCACCAGGCGTCAAAGCGGTTGGTGAAAGAAGCCGCCTCACAGGACTGTTCGGTAATCGTATTCGAGGACCTGAAACGGATACGAG
ACCGGATTTCTGGCGCCTCAAAGTTCCAACAATGGGCGTTCCGCGAGTTGAAACGCCAAGCCGAATACAAAGCTCGTGCGCATGGAATCGCCGTCGAGTC
AGTCCACCCGGCCTACACCAGCCAGCGGTGCAGTCACACCAATTGTGGCTTCACCCACGAGGACAACCGCGACGGCGACGAGTTTGCCTGTCAGAAATGC
GGCAAGGAGCTACACAGCGACTACAATGCGGCACGAAACATAGCACATCGGTATGTCCAGAATCGGCTCAAGTCTGGTTCTGGACGGGCGACCAATCACC
TCGCCCTGAAGTCGGGGACGCTGAACGGAAACGGCGACTACTCGCCTTCCACAGTATAGTGGACAGACCGGGAGTCAACCGACAAACCTCGCCGTTCACG
GCGAGGTAGGTGAT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1218 bp405 aa1421359+No
ORF function : Accessory Gene
AG : TnpB

ORF sequence :

MELQRTAVVKLSVPNERQDDLKRTMDTFRDASQRFADRGWQGDDSGYVITSRSRLQPLVYDDIREDTGLHSDLTVAAVNHASDALSGCVDRMKEGERTSK
PVFTSNTTVYNTNAITYFDGYCSLAAYGSGRVHAEYVYPDDSLQAEYMEGDEWTKQGAKLRYDCQSDTYYLHVSVKQEREDSSEGAESRTVLGVDRNVDG
YLAVTSTGAFIGNADLLNHKRREYERRRNRLQQTGTRNAHLTIQSIGDTFANWSEDFLHQASKRLVKEAASQDCSVIVFEDLKRIRDRISGASKFQQWAF
RELKRQAEYKARAHGIAVESVHPAYTSQRCSHTNCGFTHEDNRDGDEFACQKCGKELHSDYNAARNIAHRYVQNRLKSGSGRATNHLALKSGTLNGNGDY
SPSTV

 

Blast result :
Comments
ISHsal2 is 74% (TnpB) aa similar to ISNph9.
The cleavage site on the left end seems to not correspond to the guide sequence near the secondary structure.
References
1] Pfeiffer F., Marchfelder A., Habermann BH., Dyall-Smith M. (2018) Direct submission.