ISPa92

  • Family IS1182
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Pseudomonas aeruginosa
Pseudomonas aeruginosa
DNA section
IS Length : 1587 bp

Ends


IR Length :

IRL : GAGGCTGTGTGAAAACTCCGCCTCTACTGGCATGATCTGAGCACTGGCCG
IRR : GAGGCTGTGTAAAAACTCGTATGCGCGGGCTGGCGACGCCGACGTAGCCA

Insertion site


Left flankDirect repeatRight flankDR Length
GTCCGCTGATGGCCGGCAGCAGCC4

DNA sequence

GAGGCTGTGTGAAAACTCCGCCTCTACTGGCATGATCTGAGCACTGGCCGATGGGTGCTCTGCATGAAGCGATTCGTGGATGGCGTTGATCGTTCCCAAG
GGCTTTTGCTCCCTGATCGGCTGGAAGACTTCGTCCACGATGACAACCCGGTGCGGGTGGTTGATGCCTTCGTGGAAACCCTCGATCTGAACAGGCTGGG
CTTCGAGGCCGCCAATCGCGTGGCTGGGGGGCGTCCTGCGTATCACCCCGCGGCACTGCTCAAGATCTATATCTACGGTTACCTCAACCGCATCCAGTCC
AGCCGTCGTCTGGAGCGGGAGGCACAACGGAACCTGGAGCTGATCTGGTTGACTGGCCGGCTGGCGCCGGACTTCAAGACCATCGCCGACTTCCGCAAGG
ACAACGGCAGCGCGATCACCGCGGTGTGCAGCCGGTTCGTCAGCCTCTGCCGGAACATGAAGGTCTTCTCGCACGCGATCGTCGCGATCGATGGCAGCAA
GCTCAAGGCGGTGAACAGCCGGGATCGCAACTTCACCGTTGGCAAGATCAAGGGGCGCCGGCAGCAACTGGAGGAGAGCGTTGCGCGCTATCTGGCCGAG
ATGGACCGCGCGGATCGTGATCCAAGCTTGTTGCCAGAGGGGCGCGTTCCGCACCTGAAAGACAAGCTGGCGAAGCTGCGCGCGCAGATGGAGACGCTCG
ACGCTATCGAGAAGCAGCTCGAGGCTGCGCCAGTTAACCAGATATCGCTGACGGATCCGGACGCGAGATCAATGACCTCAAGTGGTCGTGGCACGGGAAC
GGTTGGCTACAACGTTCAGGTGGCGGTCGACGCCGAGCGTCATCTGATCGTCGCTCATGACGTGACGAACGACGGTCACGACCGCGCGCAGCTCTCGCGC
ATGGCAACGAAGGCAAGGGAAGCCCTTGGCACCGAACGCATGACGGCACTGGCAGATCGTGGCTACTTCAATGCGCCAGAGATCCTGGCGTGCGAGGAGG
CAGGCGTCATTCCGTTGGTGCCCAAGCCGCTCACGTCGAACAGCAAGGCCGAAGGCCGGTTCGACAAGCGGGACTTTGTTTATGACGAAGCCGCGGATGA
GTACGAATGCCCAGCAGGCGAAAGAGCGATCCATCGCTTCACGGCCGAAGAAAAGGGCCTGACCCTGCGTAAGTATTGGTCCTCGGCCTGCCCCCGCTGC
CCGATGCGGGCGCAATGCACGACCGCAAGCTATAGACGAATCACCCGCTGGGAGCACGAACACGTGCTCGAACGAATGCAGATGCTGCTGGATGCCAAGC
CGGAAGCGGCCGTAGCACGGCGACAGACGGTTGAGCATGTCTTCGGCACGCTCAAATCGTGGCTCGGAACGACGCCATTGCTGACCAAGACACTTCCAAA
GGTCAAAACGGAGATCAGCTTGGCGGTTCTGGCCTACAACATGAAGCGGATGATCAAGATCATGGGCACCGATGGCATGGTGCGGGCCATCGCGGCCTAA
TCATCACGCTTTTTGCTGTATCGCCGGCCGCTCGAACTGGCTACGTCGGCGTCGCCAGCCCGCGCATACGAGTTTTTACACAGCCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1437 bp478 aa3081744+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKRFVDGVDRSQGLLLPDRLEDFVHDDNPVRVVDAFVETLDLNRLGFEAANRVAGGRPAYHPAALLKIYIYGYLNRIQSSRRLEREAQRNLELIWLTGRL
APDFKTIADFRKDNGSAITAVCSRFVSLCRNMKVFSHAIVAIDGSKLKAVNSRDRNFTVGKIKGRRQQLEESVARYLAEMDRADRDPSLLPEGRVPHLKD
KLAKLRAQMETLDAIEKQLEAAPVNQISLTDPDARSMTSSGRGTGTVGYNVQVAVDAERHLIVAHDVTNDGHDRAQLSRMATKAREALGTERMTALADRG
YFNAPEILACEEAGVIPLVPKPLTSNSKAEGRFDKRDFVYDEAADEYECPAGERAIHRFTAEEKGLTLRKYWSSACPRCPMRAQCTTASYRRITRWEHEH
VLERMQMLLDAKPEAAVARRQTVEHVFGTLKSWLGTTPLLTKTLPKVKTEISLAVLAYNMKRMIKIMGTDGMVRAIAA

 

Blast result :
Comments
ISPa92 is 75% aa similar to ISPpu16.
References
1] Botelho J (2018) Direct submission to ISfinder