ISHsal15

  • Family IS1595
  • Group ISH4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Halobacterium salinarum
Halobacterium salinarum DSM 3754
DNA section
IS Length : 945 bp

Ends


IR Length : 20/25

IRL : CGCTCATCTCGACAAGTCGTAACATCAATTTGGATGGCGGATCAATGACC
IRR : CGCTCATCCCGATACATTGTAACATAGGAGTTTCTCGAACCAATCTTCGG

Insertion site


Left flankDirect repeatRight flankDR Length
GATATTCCTCTTCACCTGTATTGA0

DNA sequence

CGCTCATCTCGACAAGTCGTAACATCAATTTGGATGGCGGATCAATGACCAGTCAACGATGGATGAGGAGTCCGCTCAAGTCTTCCTACCATCACGTGAG
CGATGTTTTGAACGTCTCCGTCTCGCCCGCTTCGGCGAGACGGTGACGTGTGTCCATTGCGAGAGCGACAACGTTGTGAAGCGAGGGACGACCGGTAAAG
ACGCCCAACAGCACTGGTGCAAGGAGTGTGAGACGTATTTCAACGACCTCACGAACACGATTTTCGGTCAGCATCGCTTCGAACTCGAAGAGATGTTCTA
CATCATCAAGGAGATGCGATCTGAGCCGACCGCTCAGATCGCTCGTGACCTTGGCCGAGACTACGAAGCTGTTCTCAACTTTGTCCACAAAGTCCAAGAC
GTGAGTGGGGAGATCGATGAATTTGAACTGTACGAGGTCTGTGAAGCTGACGAAGTCTACGTGACAGCCGGCGAGAAGGGGATCGAAGACGAAGATGAGA
GTCCGCGCGAGCGCGGACTCAAAAAAAGGGACGAGGACGATTCGAATCAGACAAACCGCCAGTGCTGACACTCGTCCGTCGCTCCGACGGACGAGTTCGG
TTTCTCGTCTGCAAGAATCTCCAAGGTACCGACGAAGACATCGCTGAGTATGGCGACGGCAGCGTCATCCTCTGTACTGACGATTACTCGATTTACGATG
GGATCGAGAACAAGGAGGGGGTGGACGGCCATCTGGCCGTCACCCACTCCGACACCTATGTCATCGGCGATGCCCACACAAACACCTGCGAGAACCGCCA
CAGTTTCCTTCGCCAGTGGCTGGCGAAGTTCAGGGGTGTCTCGAAGCATCATCTTCAGAAGTATCTCAACTTCCTTGCACTGAAGCTCAACTCACCCGAA
GATTGGTTCGAGAAACTCCTATGTTACAATGTATCGGGATGAGCG
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
510 bp169 aa59568+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MDEESAQVFLPSRERCFERLRLARFGETVTCVHCESDNVVKRGTTGKDAQQHWCKECETYFNDLTNTIFGQHRFELEEMFYIIKEMRSEPTAQIARDLGR
DYEAVLNFVHKVQDVSGEIDEFELYEVCEADEVYVTAGEKGIEDEDESPRERGLKKRDEDDSNQTNRQC

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
444 bp147 aa499942+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

ESARARTQKKGRGRFESDKPPVLTLVRRSDGRVRFLVCKNLQGTDEDIAEYGDGSVILCTDDYSIYDGIENKEGVDGHLAVTHSDTYVIGDAHTNTCENR
HSFLRQWLAKFRGVSKHHLQKYLNFLALKLNSPEDWFEKLLCYNVSG

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
884 bp293 aa59942+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDEESAQVFLPSRERCFERLRLARFGETVTCVHCESDNVVKRGTTGKDAQQHWCKECETYFNDLTNTIFGQHRFELEEMFYIIKEMRSEPTAQIARDLGR
DYEAVLNFVHKVQDVSGEIDEFELYEVCEADEVYVTAGEKGIEDEDESPRERGLKKGRGRFESDKPPVLTLVRRSDGRVRFLVCKNLQGTDEDIAEYGDG
SVILCTDDYSIYDGIENKEGVDGHLAVTHSDTYVIGDAHTNTCENRHSFLRQWLAKFRGVSKHHLQKYLNFLALKLNSPEDWFEKLLCYNVSG

 

Blast result :
Comments
ISHsal15 is 96% aa similar to ISNpe28.
The third ORF is the putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
References
1] Pfeiffer F., Marchfelder A., Habermann BH., Dyall-Smith M. (2018) Direct submission.