TnDra1

  • Family Tn3
  • Group
MGE type TransposonRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP015084 ND Deinococcus radiodurans
Deinococcus radiodurans R1 plasmid CP1
DNA section
IS Length : 8954 bp

Ends


IR Length : 46/52

IRL : GGAGGTGGTTTAAGGAAGCTGCTACGAAGCGCAAAGTGAGGAGTTTCCCG
IRR : GGGGGTGGTTTAAGGAAGCTGCTATCAAGCGCAAAGTGAAGGCTTTCCCG

Insertion site


Left flankDirect repeatRight flankDR Length
TCTCCCCGTGCTCCCAGTTCGTGCGGTCCAGACTCAGCAAGACCTTCCCCGGTGG5

DNA sequence

GGAGGTGGTTTAAGGAAGCTGCTACGAAGCGCAAAGTGAGGAGTTTCCCGAGGCAGAATCAGGCGGATTGTTGGGCTTCCAATCTGCACAGCACCCGCTC
CAGCGCCCGTGCGTTGCCACTCTGGACACAGCACTCACAGATACAGACATCCAAGTCTCGATACACTCGCCAGCCCTTTGTCCCAGCGACCTCCCACGCC
TCCTCTTCATTCGCCTGCCGGGCTGTGCTGTCGCCGCAGGCGTCACAGAGAAGGTACACGCCCTGACCCTGGGGTCTGACGTGATTGCGGGTTCGCCAGG
CCGCTACCCCATCGAGGTGCGAGGAGACGGAAGACAACAGGGGGCTGGCCTTTCCCGCTCGCGCATCCTCAACAATGCGCGCTGTACGCGACTGCATCCG
GCGCATCAGTTCCGTGCCAGCCTGATCCATCGTGTAGACCGGCACATGCATGCCCTGGACATAGGCATGACCCACGATCACATGGTCCGGGAAGGCGGCG
CGGAGCCAGTCTTCCAGGTGATCGAGGGCTTCCCGGTAGGTCCGCTCAGCGATCAGGACGAACGCGTCGCGTTCGTCCTCGAACCGTAAGCAGTGGGTCA
GCGTCGGGCCCCACAATACGCGCCATTCCCGTACGCACGCTTGCAGCCGCAAGAAGTCAGGTTCAGACACCCGCTCAAGCCCCAGCAGCATCACGTCGGC
GGTACTCATTCTGTGAGAAGCATAGCCGTGGATGAAAGCCGTTTAAAGGTAGAAATCTACTGGTAGTCTTCTCCCACACCTTTGTGTGCGGTAGAAAACT
CGGCTGACCAGTCCCGCAATTCCTGACAGAATTACGTTATCCGCGTATTTCTCAGATTCGCCGGGAGGTCTCCTTGCTGGTCCGCAATGCACAGCTCCAG
GTCGTCAGCACCCAACCCCTCATCGCCCGCTTGCTCGAAGATGCGCTCCATGCCCGTCTCCCTGAATTTCCGGCCGCCTCGCTGGTCCTGGACTGGCCGG
TCGGCTTTGCCTTTCAGGTTGTGACGCCAGAATCGGCGGCCAGTAGCTTCGTCCTGACCCAGAACGCCTGTCCCGAGTACCTCGATGATCTGTGGAACCT
GGGCCTGCTGGGCTTGGCGTACCGGAGCCGCACCCTGGAGGAACTCGCGGAGTTACTGCGGCGTGCAGAAACCCAGGAGCGGGTCCGCTTGACGCCTGCT
CAGCGCTCTCCTTTGACGCCAGCGGAAGGGGACTTGCTGCGCCTGGTAGCACGCGGTCTCGCCAACAAGGAAATTGCCCGTGAGTTGGGGATTGCCAACC
AGACGGTGCAGAACGGGTTGACGCGCGTGTTTCAGAAACTTGGTTGCGACGGGCGCAGTGAAGCCATCCTGCACTACTGGGGGCTGACGGCTGCGACCAA
AGAGCCTCTCTGAATGCAGTTTGTTGCCTGAGCCTGCAATCGAACTCCCATGACGGCACCGCTCCTGATTCAAGGAGCGGTGCCTCCGTCTTTAAAAGCG
GTCGCCTATCCACAACGACGTGAGCGCACGGAACAGGGAGAAATCCGCCGGTAGCTCTGGACCAAAATTCCGGTAGAAACCGTTCTTTCGCACGAATTAT
GTCCAAAGCATACTCATTCGTGAGGTGGCCGCTTCGCTCAGCGTTGAGAACGACGGTCTCAACACGGTTCTCGCTCTTTCATGACCCATTTTTGGGAAAG
GAACAGACCATGCCTTACGACGTTTTGATTGATCCTGGACACGGTGGCGCCGACAGTGGCGCGGTAAATTCGAAGACCAACACTTTGGAAAAGAACTTGA
ACATGGATTCGTCTCTGTCTGTGGAGTATTTCCTCGGCCAACGCGGCAGGACGACGAAAATGACCCGCACCACGGATGTCGATATTGACAACTACCAGCG
CGCCTACCAGGGCGTCAGGGAAGGTGCCAAGATTTTCGTCTCGGTGCACCATGACTCTGCCGAGGTCGGCCGCTCGCTGGTGTACCACGACAACAAGGCT
GAATCGATTCGCCTCGCGAACAAGGTGGCAGGCTACATGGGGGGTATCTCGGTCGTGAGCATGAACCAGAGTCCCCACGGCCGCCTCTACATCGCTGATT
TCACGACCGGGCCGTCCATCCTGATCGAGATGGGGCCAACTCGCCCTTACACCCGTGATGAGCGGATCGCACGCTGTCAGCCTGCGGCCAACGCCATCGC
GGACTTCATCGCCAACAACTTCTCGTAAACTTTCCTGAAGATGCGGGCAGCCTGTGGCTGCCCGCATCTTTTCTGTTATGTCAGGCCAATGAGCACCGTC
CGGTAACTTTTTCCGTTGGAGAATTTGAGCGTTACGAGATAGCTGGTGAGATAATATCTGCTGCCATAACGCTTTTTCGCTTCTCTACGTAAGCGACCTT
GAGCATCGTCAAGCTTGAGAATAATCCGGTTGCTCTCAACCCTCCAGCCTGGCGTGCTCCCGGACTTATTGAGTACAAAGGACTGATGGCCCAGCATGTC
GCACTGACGCTCATCGCAGGCGTTGGTCTGATGCACGTAGGTCACGGTGACGCTGACTGGCACCACCATCTGGGTGGTACGCACGTATTCATCACTGCCG
ATCACCCCGTATAGCCCATCTGAGGCTTGCAGAAGATGCTGGCTGCGCGGCTGCACCTGGTAGATCAGCCGAAAGCTACCGTCTCGAAGCGTAGAAGGGC
CAGCCATGCCGCCCGTCAGACCCACACTGGAAAGCAGCAAAGCGCTGGTACAGGCACCTGTACGCCATACCTTAATCATAACCGCAGCATAAAGCAGTCG
TCTCTCCCTTCTTTTGGGTGACGCCGCTGGCTGCTGCAAGCTCTGATAATGGGGAGATTTCACGTCTTGTGGTGCTGTCGATAGGCAGATGGTATGGGAG
ACCGGCCAGCCTCAGCTCTCTAAGTCCAGGAGGAATAACGATGCGTAGAACCGTACGGCTCGCTCTATTTCAGTTTTTGGTCGCCACGCTGGCGAGTTTC
ACGCCTACCCTCGCCGCTAAGCCGAGCATGCAGTGGGCAGTGACGCGAAGCGCCACCCCGGCACCTTCTTCTGTTACCACCGATTCCACTCGGGTATATC
TGGTGGAAGGCCAGCGTCTTCAAGCCCGGCGACTGTCCGACGGTAAGTTAATCTGGCAAGCGGGAACTGGGATCAGCTCGCCCCTTGTGGTCGAACGGGG
CATAGTCTACGTCACAGGTCGGGCTCGCGAAGTCTTCGCTTTTAATGCGACTGACGGGCGAAAGCTCTGGTCCACGGTACTTACAGGCGTGCCAGAGCAG
TCACATGGCGGGTGGGCAGATACTCTCTCAGTTGACCACGGTATGCTCTTGGTTGCCTCCACACGAGGGATCTGGGGGGTAAACGCACGGACGGGCCAGC
AACGGTGGTTTCGCGAACTTCTTGATGCACGTGGCCCCTTAGTTCAGCTAGGGAGCATCACGGTCTGGCAGGTCTCTACGCCTCTCAAGAGTTTCACGTT
CGGCTTGCAATCGGAGACCGGCCGAGAAGTCTGGAGGGTGCAGACCGGGGCGACACCACTTCTTCAGGAAGATAAGTACGTGTTCGTGACGGTCCCCGGT
TCCCCGAGTGCTTACCGCATGATCGATGTCCCGAGCGGTCGCAGTATTCGGGTGGATCACAACTTCAGAGTTGGTGCCCCTTCAGGACAGCAACCGGCTC
AGGGAACACCTGGAGAGCTATTTGTGACAGGGATGGAGGTTTGCGTCCGCGTGACAAACGGTGAGGTTGACCGATTGAATTGCGTGAACCGGCAGCAGGG
CCGGAGGACCGGAGGAGAGGCAGATTTATTGAGGCAAGCGCTGGGTGAGCACCCTGTAAAAGTGCGTCGTCTCTTGAATGCCAGTCTTCCCTCTGGCTGT
GTGGGCACAGCAGTCAAGACCGCTGTAGGGGTCGTGCTGGTCGATGCACCGGACATGACTAAGACCCGGCTTTCTCAATTGCCGTCTCGGGCGTTTGCCT
GCTTCTTCCCTGTAAGCAACACCTTGAAGGTTGTTCCGGTAGGGGGGCAACTCATTGCCATTGACGAGAAAGGCAGACAAGTCTGGGTGGTTAACGTTCA
GGGGAGAGTCCAGCAGGTCATTCCTGTGGATGGGCGCTTATTGGTCGCCACCAGTGCTGAACTCCGCATACTCTCCTGGCCGTGAGCACACGAGGTAGGG
CCGCACTCCTGAGGAGTGCGGCCCCATTACAGCCAACTTCAGCTAATGATGCCGACCATGGTCTTGACCTTGCGGCCGTCGCCCGCATTCCGGAACTCTG
CACACAGCATCTGAGCTGAGCCGCTCGAGTCCAGGAAAATGCCGTCGAGGGCACCGAGGGTCTGTTTAATGGCTTGGCGGAACTGCCCGGCGGTGGCTCC
AAGCTGGCCACTCGCGGTCATAACGAGGTAGACATAACCCGCCTCGTTGTATACCAGGCCTGCACGCTGGATCACGCCGTCGGGGTTAGGGAGGTTTTGC
TGTGTGACTGCGATGTCCCTCCAGTTGGCGTCGTTCTGGAGGCTCATGCTCACGCCGCCCTGCGCCCAGTAATTGCTACGGTTGGTCACCGAAATTTGGC
TGGCGTTACTCACAACGCGGACCCCGATGGTTCGGCTCACGGTGTCGTGGAAGACGGTTCCGCGCGCATAGCCCACATTGGCCCAGCCGCTGCCGTAGCT
TGTGTCTTGATAAATTAGGCTGCCAACAGGAACGTCGTTGTTGACGGTCAGGGAAAGGAGGGGTTGACTTTCAATGGGCTCTCCGAGAATGTAAAAACCC
CCGTTGATTCCGTAATGTCCGCTGGCGGTTACATTGCTGTTGATGCGTCGCAGAACGATATTGCTGGCCGTGGTCTTCATATAGTGAAGTGTGATGCCGT
TGTACGTTGCTTTTCCGTAGACGTAAGCCATGTTGTTTCTCCTTGAGATGAAGTACTGAAGCGGCCGCTTCGAGAGTTAGTATGCTTCTGGCGTAGTTTT
CCTGCGAGAGTGTTTTCTACCGTAATCTCAAGGAGAACTCCTGTGAGACTTCTCCTTGGGCTCGAGGATCTAGAGTGCCGAGTCTCTGCTTGGTATTGGC
ACTTCCCTCAATGCTGGTGGGAGGTGTACCCTGCGGTGCCCCTACAGCACGCGCCATGGTGACCGACACTTCTCTGGAAGTACCGTCACTGCCGATTCCC
GGCACTTTTTCAGGGAGGCTCCATGCAGCAGCGCTGGACCATCGACGAACTCATCGACACCTGGACGCTGCTGCCCACCGAGACCGACCTGCTGCGGAAC
AAGACCGGCCCCACCCGCCTGGGCTTCGCCGTCATGCTCAAGGCCTTCCAGCACGAGGGCCGTTTCCCCTACAACACCCATGAGGTGCCCGAAGCCGTCG
TTGAGTACGTCGCCCGGCAGGTCGGCGTGGCGACCGACGAGTACCGGGCCTTCAATTGGCGCAGCCGCAACAGCAGCTACCAGCGTCAGGACATCCGGGC
GTTCTGTGGGTTCCGCGAGTTCATTACCGAGGATGCGGGCACGCTGACGGACTGGCTGAGCCAGTCCGTCGTTCCGCACGAGGCACACTCCGGCGCTGTG
ACCGAAGCTGCTCTGCGCTGGCTCCGCGAGAACGGTATCGAGCCGCCCAGCCCCGGGCGGCTCCAGCGGTTCGTGGACGCGGCGGAACGGCACTATGACC
TGCGCCTGTGTCAGACCATCCACGACCGCTTGAGCACCGATCACCGGGCAGGGCTGGAGGCGCTGCTGAGGCTGACGGTATTGGAGGAAGACCAGCCGGA
AGACCACGAGGGCCAAGGCCCTCGTGGCTCAGCCCTGCAACACCTGCGGACCAACTCCGAGAAACGCGGTGTGGAGAGCGTGGAAGAGCAGATCGAGAAA
CTGCGCCTGCTTCGCCGGTTGAAGCTCCCCCAGACGCTTTTCGCGGACGTGGCCCCCCACGTCCTGACCCGTTACCGCGAGCGGGCCTCCAACGAGTCCC
CCAGTCACTTTCGTGCCCAGATCCCACCTGTGCGTCTCACGCTCCTGGCCGCTTTCTGTGCTGCGCGTGCCGCCGAGTTGACTGATGCCCTGGTGACGCA
CCTGATGGACATGGTTCACCACATCAACGTCAAAGCCGAGCGGCGGGTCGAGCGCAACTTCGTGGCCGAGTTCCGGCGGGTCCATAACAAGGACCGCATT
CTGGAGCGGCTGCTGGAGGCCGCGCTGGGGAGTCCCGACGGCACCGTACGTGAGGTGCTGTTCCCAGTGGTGGACGAGCAGACCCTGCGTGACCTGCTGC
GTGAGTACAAGGAGAAGGGAGGCTTCCGGCAGCAGGTCCACACCATCGTGCGCGGCACCTACCGCAGCCACTACCGGCGGATGATCCCCTGGCTGCTCAC
CGAACTGTCGTTCCGGTCCAACAATCACCGGCACCAGCCGGTGATCGACGCCCTGAGCCTGCTGGGGCGGTATGTGGACAGCAACGCGAGAATCTACCCG
TCCGAGGAACACATCCCGGTCGGTGGCGTGATCGACCGGAACATCCGTGACCTGATTCTCGAACGGGGGCCGGATGGTGGAACGCGCGTCAACCGCGTGA
ATTACGAGCTGTGCGTCCTGTCCGCGCTGCGGGACGCTCTGCGTTCCCGCGAAATCTGGGTGGTCGGGGCCGACAAGTACCGCGACCCCGACAAGGACCT
GCCCCAGGACTTCGAGGCCCGCAAGGAAAGTTACTTCCAGGCGCTGAGACAGCCGCAGGAGGTGGACACCTTCGTGCAGGGTCTGGAGCAGCAGCTCAAG
GACGCCCTGGTGATGCTGCACGACGGCTTGCCGAAGAATCCTGGCGTGCGGGTGGTCGCGCGGGACGGGGGCCGCTTCGTGGTCACGCCCCTGACCCGGC
AGCCGGACCCGCCCTTCTACGACACCTTGAAGGGCGAGGTGGGGCGGCAGTTCTGGAACACCCAGTTGCTCGATGTCCTGGTCGAGGTGGACCGACGTGC
AGGGATTACCCCGCACTTCAAGAGCTTCATGACGCGCGAGAACATGCCGCGTGACCAGCTCCAGCAGCGCTTGCTGCTGTGCCTGTACGGCCTGGGGACG
AACACGGGACTGAAGCGGGTGGCCGCCGGGCAGGACGGGGTCGGGTACTCGGACCTGAAGTACGTCCGGCGGCATTACATCCACCGCGACGCGCTGCGGG
CGGCGAACGCCGCGGTGGTGAACGCCACGCTGGCCGCGCGCCGCCCGGACATCTGGGGCGAGGGGACCACCAGTTGCGCCAGTGATGCCAAGAAATACGC
CGCCTGGGACGGGAACCTGCGGACGCAGCGGTCTATCCGGTACGGCGGGGACGGGGTGATGATCTACTGGCACGTCGAGAGACGGGCCAGTTGCATCTAC
TCCAGCATGAAGTCCTGCTCGTCGTCGGAAGTCGCCGCGATGATCGAGGGCGTGCTGCGTCACTGCACCACGCTGTCCGTCGAGAAGAACTACGTGGATA
CCCATGGGCAGAGCGAGCCGGGCTTCGCCTTCACGCACCTGCTGGGATTCAAACTGATGCCCCGTCTGGCGGACATCGCCCATCAGCGGCTTTACCTGCC
GAATATGGCGTTCGCGGCGCAGGTGCCGAACCTCGCCGCTGTGCAGGCACAGCGGTCGATCCGCTGGGACCTCATCCGCCAGCAGTACGAGCCGATGGTC
AAGTACGCGACGGCTCTGCGGCTGGGGCTGGCCGACCCCAAAGCCATTCTGCAACGCTTCACCCGGGCCAACGCCCAGCATCCGACCTACGCAGCCCTGT
GCGAACTGGGGAAGGTGCTGCGGACGATCTTCGTCTGCGAGTACCTGCACCGGGAGGAGGTGCGCCGGGAGATTCACGAGGGGCTGAATGTCATCGAAAC
TTGGAACGGCACGACCAACTTCATCTTTTTCGGCAAGGGTGGGGAGATCAGCACCAACAACCTCGAAGGGCAGGAAATCTCCATGCTGGCGCTGCAACTG
CTGCAAAACAGCCTGGTGTACGTCAACACCCTGATGATCCAGCGGGTGCTGGGCAGCGAAACTTGGCGACAGCGGATGACCGCCGAGGACTGGCGGGCCC
TGTCCCCCCTGATGCACCACCACATCAACCCATACGGGGAGTTCAAACTGGACCTGACCCACAGGCTCAAGCTGGAGGTCGAGGTGGACGCATGACACAG
ACGCGGCGCACCGGGGCGAAGAAGAAAGCGCGTGAACTGGCGAAACTGCTGCGGGCTGAGCGGCCAGACTACGCCTACCTCAAGGAAGTGTTCCGTCATC
TGCGGGCCGAACTGGAAGTGGAGGTGCCGGGACCGTCACGCCGTCTGCCGTGGGTGCCGACCGAGGAGCAGGTGCGGGCGTTCTACGAGGCGGTGTGGCG
CACGCGCCGCACCGCTGACCTCGTGCTGATCAAGACCTTCCTGTACACCGGTGTACGCGTGTCCGAACTGGTGATGATGCGCCTCGCGGACGTGGACCTG
GACGCCTGCCAGATCCGGGTAAACCTGGGGAAGGGGAGCAAGGACCGGGTGGTGCCGTTCCCAGCACCCTTCAAGGAGACGCTGGCGCTTCATATCGGCC
AGAGACGACAACAGGGAGGAATCTACCTGTTCGAGTCGTCGTGGAAACGTCGCTACAGCGACCGGGGCGTGCGGCGGATGTTCGAGCGGTACACGGCCCT
GGCGGAGATCGACCGCAGCCTGTCGCCGCACAAGCTGCGGCATTTCCTGCTGACCTGGCTCAAGAAACAGGGCCTCGACGACGCGCTGATTCAGCCGTAC
AGCGGCCATGCTTCCCGGCAGTCGTTAGAAATCTACTCGCGGCTGGCGCTGGGCGAGGCCCAGCGCGAGTACGACCGGGTGATCGGGCGTTTTCCTGTAT
AGCTCGGGAAAGCCTTCACTTTGCGCTTGATAGCAGCTTCCTTAAACCACCCCC
Protein section
ORF number : 8

 

ORF 1
LengthBeginEndStrandFusion ORF
651 bp216 aa70959-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MSTADVMLLGLERVSEPDFLRLQACVREWRVLWGPTLTHCLRFEDERDAFVLIAERTYREALDHLEDWLRAAFPDHVIVGHAYVQGMHVPVYTMDQAGTE
LMRRMQSRTARIVEDARAGKASPLLSSVSSHLDGVAAWRTRNHVRPQGQGVYLLCDACGDSTARQANEEEAWEVAGTKGWRVYRDLDVCICECCVQSGNA
RALERVLCRLEAQQSA

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
540 bp179 aa8741413+No
ORF function : Passenger Gene
Annotation : Helix-turn-helix transcriptional regulatorDescription : Transcriptional Regulator factor

ORF sequence :

MLVRNAQLQVVSTQPLIARLLEDALHARLPEFPAASLVLDWPVGFAFQVVTPESAASSFVLTQNACPEYLDDLWNLGLLGLAYRSRTLEELAELLRRAET
QERVRLTPAQRSPLTPAEGDLLRLVARGLANKEIARELGIANQTVQNGLTRVFQKLGCDGRSEAILHYWGLTAATKEPL

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
426 bp141 aa18032228+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MDSSLSVEYFLGQRGRTTKMTRTTDVDIDNYQRAYQGVREGAKIFVSVHHDSAEVGRSLVYHDNKAESIRLANKVAGYMGGISVVSMNQSPHGRLYIADF
TTGPSILIEMGPTRPYTRDERIARCQPAANAIADFIANNFS

 

Blast result :
ORF 4
LengthBeginEndStrandFusion ORF
504 bp167 aa27792276-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MIKVWRTGACTSALLLSSVGLTGGMAGPSTLRDGSFRLIYQVQPRSQHLLQASDGLYGVIGSDEYVRTTQMVVPVSVTVTYVHQTNACDERQCDMLGHQS
FVLNKSGSTPGWRVESNRIILKLDDAQGRLRREAKKRYGSRYYLTSYLVTLKFSNGKSYRTVLIGLT

 

Blast result :
ORF 5
LengthBeginEndStrandFusion ORF
1245 bp414 aa29414185+No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MRRTVRLALFQFLVATLASFTPTLAAKPSMQWAVTRSATPAPSSVTTDSTRVYLVEGQRLQARRLSDGKLIWQAGTGISSPLVVERGIVYVTGRAREVFA
FNATDGRKLWSTVLTGVPEQSHGGWADTLSVDHGMLLVASTRGIWGVNARTGQQRWFRELLDARGPLVQLGSITVWQVSTPLKSFTFGLQSETGREVWRV
QTGATPLLQEDKYVFVTVPGSPSAYRMIDVPSGRSIRVDHNFRVGAPSGQQPAQGTPGELFVTGMEVCVRVTNGEVDRLNCVNRQQGRRTGGEADLLRQA
LGEHPVKVRRLLNASLPSGCVGTAVKTAVGVVLVDAPDMTKTRLSQLPSRAFACFFPVSNTLKVVPVGGQLIAIDEKGRQVWVVNVQGRVQQVIPVDGRL
LVATSAELRILSWP

 

Blast result :
ORF 6
LengthBeginEndStrandFusion ORF
642 bp213 aa48804239-No
ORF function : Passenger Gene
Annotation : Hypothetical proteinDescription :

ORF sequence :

MKTTASNIVLRRINSNVTASGHYGINGGFYILGEPIESQPLLSLTVNNDVPVGSLIYQDTSYGSGWANVGYARGTVFHDTVSRTIGVRVVSNASQISVTN
RSNYWAQGGVSMSLQNDANWRDIAVTQQNLPNPDGVIQRAGLVYNEAGYVYLVMTASGQLGATAGQFRQAIKQTLGALDGIFLDSSGSAQMLCAEFRNAG
DGRKVKTMVGIIS

 

Blast result :
ORF 7
LengthBeginEndStrandFusion ORF
2973 bp990 aa52238195+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQQRWTIDELIDTWTLLPTETDLLRNKTGPTRLGFAVMLKAFQHEGRFPYNTHEVPEAVVEYVARQVGVATDEYRAFNWRSRNSSYQRQDIRAFCGFREF
ITEDAGTLTDWLSQSVVPHEAHSGAVTEAALRWLRENGIEPPSPGRLQRFVDAAERHYDLRLCQTIHDRLSTDHRAGLEALLRLTVLEEDQPEDHEGQGP
RGSALQHLRTNSEKRGVESVEEQIEKLRLLRRLKLPQTLFADVAPHVLTRYRERASNESPSHFRAQIPPVRLTLLAAFCAARAAELTDALVTHLMDMVHH
INVKAERRVERNFVAEFRRVHNKDRILERLLEAALGSPDGTVREVLFPVVDEQTLRDLLREYKEKGGFRQQVHTIVRGTYRSHYRRMIPWLLTELSFRSN
NHRHQPVIDALSLLGRYVDSNARIYPSEEHIPVGGVIDRNIRDLILERGPDGGTRVNRVNYELCVLSALRDALRSREIWVVGADKYRDPDKDLPQDFEAR
KESYFQALRQPQEVDTFVQGLEQQLKDALVMLHDGLPKNPGVRVVARDGGRFVVTPLTRQPDPPFYDTLKGEVGRQFWNTQLLDVLVEVDRRAGITPHFK
SFMTRENMPRDQLQQRLLLCLYGLGTNTGLKRVAAGQDGVGYSDLKYVRRHYIHRDALRAANAAVVNATLAARRPDIWGEGTTSCASDAKKYAAWDGNLR
TQRSIRYGGDGVMIYWHVERRASCIYSSMKSCSSSEVAAMIEGVLRHCTTLSVEKNYVDTHGQSEPGFAFTHLLGFKLMPRLADIAHQRLYLPNMAFAAQ
VPNLAAVQAQRSIRWDLIRQQYEPMVKYATALRLGLADPKAILQRFTRANAQHPTYAALCELGKVLRTIFVCEYLHREEVRREIHEGLNVIETWNGTTNF
IFFGKGGEISTNNLEGQEISMLALQLLQNSLVYVNTLMIQRVLGSETWRQRMTAEDWRALSPLMHHHINPYGEFKLDLTHRLKLEVEVDA

 

Blast result :
ORF 8
LengthBeginEndStrandFusion ORF
711 bp236 aa81928902+No
ORF function : Accessory Gene
AG : Tn3 resolvase

ORF sequence :

MTQTRRTGAKKKARELAKLLRAERPDYAYLKEVFRHLRAELEVEVPGPSRRLPWVPTEEQVRAFYEAVWRTRRTADLVLIKTFLYTGVRVSELVMMRLAD
VDLDACQIRVNLGKGSKDRVVPFPAPFKETLALHIGQRRQQGGIYLFESSWKRRYSDRGVRRMFERYTALAEIDRSLSPHKLRHFLLTWLKKQGLDDALI
QPYSGHASRQSLEIYSRLALGEAQREYDRVIGRFPV

 

Blast result :
Comments
TnDra1 is 66% (transposase) aa similar tp ISNpu13
References
1] ISfinder annotation (2018)
2] White,O., Eisen,J.A., Heidelberg,J.F., Hickey,E.K., Peterson,J.D., Dodson,R.J., Haft,D.H., Gwinn,M.L., Nelson,W.C., Richardson,D.L., Moffat,K.S., Qin,H., Jiang,L., Pamphile,W., Crosby,M., Shen,M., Vamathevan,J.J., Lam,P., McDonald,L., Utterback,T., Zalewski,C., Makarova,K.S., Aravind,L., Daly,M.J., Minton,K.W., Fleischmann,R.D., Ketchum,K.A., Nelson,K.E., Salzberg,S., Smith,H.O., Venter,J.C. and Fraser,C.M. (1999) Science 286 (5444), 1571-1577.