ISEfa15

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
MF580438 ND Enterococcus faecium
Enterococcus faecium
Enterococcus faecium E35048 plasmid pE35048-oc
DNA section
IS Length : 2500 bp

Ends


IR Length : 39/50

IRL : TGTTTATGATAAGCTAAAAGTACCCCAAATTCTAATTGAAAATTCCCCTA
IRR : TGTATTTGTCAAGCGAAATTTCCCCCATATTCTAATCGAAAACTCCCCTA

Insertion site


Left flankDirect repeatRight flankDR Length
CTTTAAACAACAGCACCCTAATTTTGATGAACTAGTGAA5

DNA sequence

TGTTTATGATAAGCTAAAAGTACCCCAAATTCTAATTGAAAATTCCCCTAGAGGAAATATATAATATCCCTATGACAACTCATAGGGGGGACTAGGGGAT
GATAAGTTTAATGGATAAACAGAAGATAATAATAGATGGATTTTTAAATGGAAAATCTCAATGGGGAATCCATAGGGAAACAGGAATTTCTAGAAAAACA
ATTAGGAAATATATTAGGGAGTATGAAGAGAAGAGATCCAAATTATTAGAAGGAGAAGGTGATAAATTAATACTTACTGAAGAGATGATAGAGCCGCCAA
AATATGATTCTAGTAACAGACAAAAGGTAAAGTTAACAGATGAAATAATGGCTAGGATAGATTTTTATCTAGAGGAAAATGAAGAAAAAAGAAGGATCGG
CAAGAGTAAACAACAAAAGAAAAAAATAGATATACATGAGTGTTTAGTAGAAGAAGGCTACGACATAAGTTATCCGACAGTATGTAACTATATAAGGAAT
ATATCAGATGAAAAAAAGGAGGCCTACATCAGGCAAGAATATGAATTAGGAGATGTATCTGAATTTGATTGGGGCCATGTTAAATTAGAAATAAATGGGG
AGTCTAAAAACATACAAATGGCTGTAATGACAACAGCTAAGGGTAACTACAGGTTTTCGTATCTTTATCAAAATCAGAAGATGGAGAGTTTCCTAGATTC
ACATGTCAGATTTTTTAATCATGTGGGAGGTGTTCATAGGGAAATAGTATATGACAATATGAAGGTTGCAGTTAAGAGATTTGTAACAAAGGCTGATAAG
GAACCAACTGATGGACTTTTAAAACTATCCATGTATTATGGATTTAACTATAGATTTTGCAATGCTAGACGTGGAAATGAAAAAGGTCATGTGGAAAGGT
CAGTAGAATATGTAAGAAGAAAGGTATTTAGTAAAAAGGATACATTTGAAACACTAGAGGAGGCCAATAAGTATTTAGAAGAGGAACTGAATAAATTAAA
TTCAAAACCGCAGAAGTACAATGAAAACAAAACAGCAAAGGATATATTAATAGAGGAATTCCCCTACCTAATAAAACTTATGCCTACTTATGATATTGCA
AGGGTGGTGGAATTAAGGGTAAATAAATATTCAGTAATTTCAATAGATGAAAATAAATACTCAGTACCTGATTCTCTAGTCGGTAAATTTGTAACAGCAA
AAATATATCCAAATAATATAACAATCTACCATGAAAACATAAGGGTAACTGAGCATAAGAGGAGTTTTGGATTAAGTACATGGAATATAAAAATAAAACA
TTACCTAAATACATTAAAAAAGAAGCCTGGGGCAATTCATAACAGCACAGCCATGCGTCAAATGAATTCCAAGCTTCAAAACATATACAATAAATATTAT
ACCCAAAATCCAAGGGATTTCATAGACCTAATTGAATTAATTTCAGAAGAAGGTTTGGAAAGGATAGAAGAGATTATAAAAGAATTAGAAAGGATAAACC
CATTAAATATAGACACGGAAAAAATAAAGCTTCTGTGCCACAGAAAGGATGAATCCATAGGGGAAAAGACATACAAAAATACAGAGATAGAAAAACATTC
AAAGCTCATCCTAAATCACTATGGAGGATTACTAAAAGGTTCACCTGTAGAATTTGATAAGGAGGCTTTGATAATATGAAAAAGGATGCAATTAAAATAA
ATATTAAAAACTTAGCAAAGGAGTTAAAATTACCATATATAAGTAAAAGCATAGAAGAAGAAATAAAAGAAGCAAATATGAAGAATTTAACATACGAAGA
TTTTATCTTGTCGGTCCTGGAAAATGAACATGATTTAAGAAAATCTAATGGAATAAAAAGTAGGATTAGGCAAGCAAGATTTCCATATAAAAAATATATA
GAGGATTTAAGTTTAGAGGATTTACCCCAAGATGCAAGAGATAAATTAAAAATCTTTTCATCCTTAGAGTTCATAGAAACAGGCCAAAATATAATACTTG
CAGGTAACCCTGGAACTGGGAAGACGCATATGGCCATAGGTATTGGTATTAAGGCTTGTACTAAGGGCTACAAGGTTCTATTTACAACAATACCACTACT
TGTAAATGAATTAAAAGAAAGCAGATCAGAAAAAACATTAAGGGCTTTTGAAAGAAGATTTGAAAAATATGATCTAATAATAGCAGATGAATTAGGGTAT
ATATCTTTTGATAAAGAGGCTTCAGAACTACTTTTTACCTACCTCTCACTAAGAGCAGGAAGGAAATCAACAATAATAACTACCAATCTATCATTTGAAA
GGTGGGATGAAATATTTAAAGATCCAGTAATGACAGCAGCAATGATAGACAGGCTTACCCATAAATCATATATAGTGAATATGAATGGCAATTCTTATAG
ATTAAAAGAGACCCAGCTTTGGTTAGAAGGGCAATAATTTTTTATCCAGCTAGGGGAGTTTTCGATTAGAATATGGGGGAAATTTCGCTTGACAAATACA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1581 bp526 aa991679+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MISLMDKQKIIIDGFLNGKSQWGIHRETGISRKTIRKYIREYEEKRSKLLEGEGDKLILTEEMIEPPKYDSSNRQKVKLTDEIMARIDFYLEENEEKRRI
GKSKQQKKKIDIHECLVEEGYDISYPTVCNYIRNISDEKKEAYIRQEYELGDVSEFDWGHVKLEINGESKNIQMAVMTTAKGNYRFSYLYQNQKMESFLD
SHVRFFNHVGGVHREIVYDNMKVAVKRFVTKADKEPTDGLLKLSMYYGFNYRFCNARRGNEKGHVERSVEYVRRKVFSKKDTFETLEEANKYLEEELNKL
NSKPQKYNENKTAKDILIEEFPYLIKLMPTYDIARVVELRVNKYSVISIDENKYSVPDSLVGKFVTAKIYPNNITIYHENIRVTEHKRSFGLSTWNIKIK
HYLNTLKKKPGAIHNSTAMRQMNSKLQNIYNKYYTQNPRDFIDLIELISEEGLERIEEIIKELERINPLNIDTEKIKLLCHRKDESIGEKTYKNTEIEKH
SKLILNHYGGLLKGSPVEFDKEALII

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
762 bp253 aa16762437+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

MKKDAIKINIKNLAKELKLPYISKSIEEEIKEANMKNLTYEDFILSVLENEHDLRKSNGIKSRIRQARFPYKKYIEDLSLEDLPQDARDKLKIFSSLEFI
ETGQNIILAGNPGTGKTHMAIGIGIKACTKGYKVLFTTIPLLVNELKESRSEKTLRAFERRFEKYDLIIADELGYISFDKEASELLFTYLSLRAGRKSTI
ITTNLSFERWDEIFKDPVMTAAMIDRLTHKSYIVNMNGNSYRLKETQLWLEGQ

 

Blast result :
Comments
ISEfa15 is 69% (transposase) aa similar to ISHahy12.
As a putative composite transposon found for the first time on plasmid pE35048-oc in Enterococcus faecium E35048, two ISEfa15 elements (one copy of which appear to be trucated at its 3'-end) in the same orientation flank the optrA resistance gene. This composite transposon may play a role in dissemination of the optrA resistance gene, as the presence of target site duplications (5'-CTAAT-3') flanking this transposon strongly suggests its transposition in a pRE25-like plasmid as F120805. Part of this transposon is able to exciss and form minicircles containing a truncated copy of ISEfa15 and the optrA gene.
References
1) D'Andrea, M.M. (2018) Direct ISfinder submission.
2) Morroni, G., Brenciani, A., Antonelli, A., D’Andrea, M.M., Di Pilato, V., Fioriti, S., Mingoia, M., Vignaroli, C., Cirioni, O. , Biavasco, F., Varaldo, P.E., Rossolini, G.M., Giovanetti, E. (2018) Front Microbiol. Manuscript submitted.