ISLdl4

  • Family IS110
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AJ316615 ND Lactobacillus delbrueckii
Lactobacillus delbrueckii subsp. lactis
DNA section
IS Length : 1651 bp

Ends


Left end : CATACTAATCTGGTGTTGGATGATTACTCGACGGAGTAGTCGTTCAACACTTTTTCTTTTACTATATAAAGTGGAGATGAAGCCAATGCCGTGCGTCTTT
Right end : TCAGATATTTGACTTGATCCTTCAGGAGTCATTTCCCGATCGAGCTCTTATTTCAAAATAAAATTGCCTAAAATCGTTGATAACACTTGACTTAGAGTAG

Insertion site


Left flankDirect repeatRight flankDR Length
AATAGGCAACAAAAAAAGAAGGGT4

DNA sequence

CATACTAATCTGGTGTTGGATGATTACTCGACGGAGTAGTCGTTCAACACTTTTTCTTTTACTATATAAAGTGGAGATGAAGCCAATGCCGTGCGTCTTT
TGGACACATGATGTCGTAAATAAAACTGGCAGCTTCACCATTCAATTGAGAATCTCGTCTAAGTATGTTGGCTGTTAAAGTCCGGTTGAGAAAATTAGAT
CTGATTGAATTGGGTGAAGGAAGCTCATCTCCAAGTAAAGCGGAGGTTTATTCTTATGGATTCATTGAAAACTGTTTTCGGTATTGATGTTAGCAGCCGG
AAGTCTAACGTATGCATTATGGTCAATGGCCAAAAAGTTAATGACTATGCCATCTCCAACGATATGGTAGGCTTCAATCAGCTGCTAGATGACCTTAAAC
AGGTTACCAACCCGCAAATTATTTTTGAAGCAACTGGCGTCTACTCCAGAAGACTCCAAGCGTTTTTGGACATGCACGATTTACGCTATGTCATGATGAA
CCCGCTGGAAGCCAAAAGAAAGACAAAGGATGACCTGCACCAGAACAAGACCGATAAGCTTGATGCAATGTATCTCGCCAAGATGCAGTCTGAGCACCCG
CAGCGGCTGGCCTACGTTCAAAGCGAAGAATATCAAGAATTGATGGCCAACAACCGCATCTACGAGCAGGCTTCGCACGATCTGATAACCAACAAGAATA
GACTGCACAAAGCCATTCAGCTCACTTTCCCAGAGATTGAGCACTTACTGGCTAATCCGAGAGGGAAAAACTACTGGAGTATTGTTCTCAAATTCCCACA
CCCTAATATCGTATTAGAAACAAAAGAAGCCGATATCATCGACTTCTTAAAGAGCTTATCTGGTATTGGTGAAAAACGTGCCAATGATTTGGCACAGAGG
CTTATCCGGCTGGCCAAGCTCGCATGCCCAGCTGTCAAAAAGAGCAGTGCACATATTCGGGCCTTAAAGGCCATTAAACATATTCTGAGCGCTGAAGAGA
CGTGCCAGACAGCTTTAAAGGAGATGGCCAAGCTCGCTCCCAAGCGTGATCTGGAGATCCTTAAAAGCATTCCTGGCATCGCCGAAAATACTGCCTTGAG
AATTATTAGTGAGCTTGGAGATATCAGACGCTTTAACAACCCCAACCAATTAAATGCCTTCGTCGGTGTTGATCCTCAGGTTTATGAATCTGGCAATCTC
ACAGCCCACCTATCAATTTCAAAGCGTGGGACAGCTATTGGCAGAAAGGTGCTGTACTTGGCCATAAACCAAATTCAGTCGGCTAAGAAAGCTGGAAACC
CTTGTCATATTGCGGATTATTACGAGAAACGAAAACGGTCTTCTGAGACTGCAAGTCACAAGAAGGCCGCTATCGCATCGATCCATAAATTATTACGGAC
GATCTTCGCTTTAATTACGAATGATCAATTGTATAGCTATGACATAGCCAAACATAACCAAAGATTTTTGTCATAAAAATTGATCCAATAGATATTATAA
CAGCCTCTTTTTTGAAATTACAGAAGGTGGCTGTATTTATCATGCCCTAAATCAGATATTTGACTTGATCCTTCAGGAGTCATTTCCCGATCGAGCTCTT
ATTTCAAAATAAAATTGCCTAAAATCGTTGATAACACTTGACTTAGAGTAG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1221 bp406 aa2561476+No
ORF function : Transposase
Chemistry : DEDD

ORF sequence :

MDSLKTVFGIDVSSRKSNVCIMVNGQKVNDYAISNDMVGFNQLLDDLKQVTNPQIIFEATGVYSRRLQAFLDMHDLRYVMMNPLEAKRKTKDDLHQNKTD
KLDAMYLAKMQSEHPQRLAYVQSEEYQELMANNRIYEQASHDLITNKNRLHKAIQLTFPEIEHLLANPRGKNYWSIVLKFPHPNIVLETKEADIIDFLKS
LSGIGEKRANDLAQRLIRLAKLACPAVKKSSAHIRALKAIKHILSAEETCQTALKEMAKLAPKRDLEILKSIPGIAENTALRIISELGDIRRFNNPNQLN
AFVGVDPQVYESGNLTAHLSISKRGTAIGRKVLYLAINQIQSAKKAGNPCHIADYYEKRKRSSETASHKKAAIASIHKLLRTIFALITNDQLYSYDIAKH
NQRFLS

 

Blast result :
Comments
ISLdl4 is 96% aa similar to ISL4.
References
1] ISfinder submission (2018)
2] Ravin,V. and Alatossava,T. (2002) Microbiol. Res. 157 (2), 109-114 .
3] Ravin,V. and Alatossava,T. (2003) Plasmid 49 (3), 253-268.