ISLbp2

  • Family IS256
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP000348 ND Leptospira borgpetersenii
Leptospira borgpetersenii serovar Hardjo-bovis L550
DNA section
IS Length : 1530 bp

Ends


IR Length : 16

IRL : GAACTTGTCCCAAAACACTAGAAGAAATCAGCGCAATCATTTCATAAGTT
IRR : GAACTTGTCCCAAAACCTCGGGTGTAGGAACTTCTACGAGAATGCTCCAA

Insertion site


Left flankDirect repeatRight flankDR Length
TTCGTCAAAATTAATTTTAATCT3

DNA sequence

GAACTTGTCCCAAAACACTAGAAGAAATCAGCGCAATCATTTCATAAGTTCGTAATAGAGCGTGTGAATTTCCGCAGATCGGTGATTTATGGCGAGGGTG
TCGGCTTGCTTGTGTAAATGACTTGTGAATAAAGTAAAAGTAACAAGGATAAAACCAAGATGAGCAAACCGAAAAATCGAGTAGAAGAGCTACTGGATGA
ATTAATCAAAGATAAGAGTGCTGAAGAACTACTGGGAAATGAAGGCCTTTTAAAGCAGCTAACGAAATCGTTGGTGGAGCGAGCGATGCAAGGAGAGCTA
ACGCACCACTTAGGCTACGAGAAGAATTCCTCGTTGGGAAAAAACTCAGGCAATTCTCGGAATGGAACAAGTGTCAAAAAGCTCAAAGGGGATTTTGGAA
CAATCGATTTGGAAGTTCCTCGAGATAGGAATGGAAGCTTTGAACCACAGATAGTCCAGAAAGGTCAGACACGTTTTACGGGCTTTGATGACAAGATCAT
CTCGATGTATTCACGCGGAATGACAACTCGAGAAATATCCGAACATCTCAAAGAAATCTATCAAGTTGAAGTCTCAGCGGATTTAATTTCTCAAGTAACG
GATTCCGTAATGGAAACGGTGATCGAGTGGCAGAATCGGCCCTAAAGTATATCCGATTCTCATCATGGACGCGTTAGTCGTAAAGGTGAGAGATGGTAAT
CATGTCGTAAACAAGGCCTTTTATTTGGCCTTAGGAATCAATCTACAGGGAACAAAAGAGATTCTTGGGATCTGGGTGGAGAAAACCGAAGGAGCCAAGT
TCTGGCTTCAGATCTTAACCGATTTAAGGAATCGCGGAGTTGAAGATATCTTAATTGCTTGTGTCGACGGATTGAAAGGATTTCCGGAAACCATTGTATC
CGTTTTTCCTAAAGCGCAAGTTCAACTCTGTATCGTTCATATGGTAAGGAATTCTTTAAAATGGGTTTCTTACAAACAGAAGAAAGAGTTGATGATTGAT
TTAAAGGCCATCTACAAATCTCCATCGGAAGAGATCGCGAAGAAAAGCCTTGATGATTTTTCAACCAAATGGGACAGTCAGTATCCGATGATCAGTAAGT
CCTGGAGAAACAATTGGGAATCGGTGATTCCTTTTTTGGCTTATCCGCCTAATATTCGTAAGGCGATATATACAACAAACGCGATCGAATCTATGAATAT
GGGTTTAAGAAAAATTATCAAAAATCGGGGATCATTCCCAACGGATGAGGCGGCAATCAAGCTTCTCTATTTAGCTTTGAATAATATGTCTAAAAAATGG
ACCATGCCAATTCAAGATTGGGATGGCGAGCGATCCTTAGAGAGCGAGCCGCTGAGTTCAAGCGATGAACCAGTTTTCGATTCTTTTCGGGGATCGATTG
AAATTAGATTCATTTTAAAATATGTCATTTACACAGTTTTGCTGATACCCTCTTTATGGATTTTCTAACGGATTTTATCGTTGGAGCATTCTCGTAGAAG
TTCCTACACCCGAGGTTTTGGGACAAGTTC
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
486 bp161 aa160645+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MSKPKNRVEELLDELIKDKSAEELLGNEGLLKQLTKSLVERAMQGELTHHLGYEKNSSLGKNSGNSRNGTSVKKLKGDFGTIDLEVPRDRNGSFEPQIVQ
KGQTRFTGFDDKIISMYSRGMTTREISEHLKEIYQVEVSADLISQVTDSVMETVIEWQNRP

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
846 bp281 aa6231468+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

SSGRIGPKVYPILIMDALVVKVRDGNHVVNKAFYLALGINLQGTKEILGIWVEKTEGAKFWLQILTDLRNRGVEDILIACVDGLKGFPETIVSVFPKAQV
QLCIVHMVRNSLKWVSYKQKKELMIDLKAIYKSPSEEIAKKSLDDFSTKWDSQYPMISKSWRNNWESVIPFLAYPPNIRKAIYTTNAIESMNMGLRKIIK
NRGSFPTDEAAIKLLYLALNNMSKKWTMPIQDWDGERSLESEPLSSSDEPVFDSFRGSIEIRFILKYVIYTVLLIPSLWIF

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1309 bp436 aa1601468+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSKPKNRVEELLDELIKDKSAEELLGNEGLLKQLTKSLVERAMQGELTHHLGYEKNSSLGKNSGNSRNGTSVKKLKGDFGTIDLEVPRDRNGSFEPQIVQ
KGQTRFTGFDDKIISMYSRGMTTREISEHLKEIYQVEVSADLISQVTDSVMETVIEWQNRPPKVYPILIMDALVVKVRDGNHVVNKAFYLALGINLQGTK
EILGIWVEKTEGAKFWLQILTDLRNRGVEDILIACVDGLKGFPETIVSVFPKAQVQLCIVHMVRNSLKWVSYKQKKELMIDLKAIYKSPSEEIAKKSLDD
FSTKWDSQYPMISKSWRNNWESVIPFLAYPPNIRKAIYTTNAIESMNMGLRKIIKNRGSFPTDEAAIKLLYLALNNMSKKWTMPIQDWDGERSLESEPLS
SSDEPVFDSFRGSIEIRFILKYVIYTVLLIPSLWIF

 

Blast result :
Comments
ISLbp2 is 78% aa similar to ISPa46.
The third ORF is the putative ORFAB transposase reconstructed in silico by possible-1 frmaeshift.
References
1] ISfinder submission (2018)
2] Bulach,D.M., Zuerner,R.L., Wilson,P., Seemann,T., McGrath,A., Cullen,P.A., Davis,J., Johnson,M., Kuczek,E., Alt,D.P., Peterson-Burch,B., Coppel,R.L., Rood,J.I., Davies,J.K. and Adler,B. (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (39), 14560-14565 .