ISAlw3

  • Family IS1
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
DNA section
IS Length : 788 bp

Ends


IR Length : 24

IRL : GGTGGTGTTTCAAAAAGTATGCTGAAAAAAAGCAGGTTGGATTTTGATAA
IRR : GGTGGTGTTTCAAAAAGTATGCTGGCATTAAACGAATCCATTATTGATAT

Comments : 24/24

Insertion site


Left flankDirect repeatRight flankDR Length
atattaattgaatacgacttaataattgaataataaggaagatcagca8
attctaacttcgatttatttaaaaattgatttactttgattttttatt8

DNA sequence

GGTGGTGTTTCAAAAAGTATGCTGAAAAAAAGCAGGTTGGATTTTGATAAAATAGAGAAATGCGAATAACTCTAGAAATCAAGTGTCCAGCCTGCCTAAG
TGACAGTATAAAGAAAAATGGCACAAAAGTAGATGGTAAGCAAAATTACCAATGTAAAATATGCAGACGTCAATTTATTGGTGATCATGCTCTCAGTTAT
CAAGGCTGTCACTCAGGTATCAAAACCAAAATATTACACCTCATGGTGCGAGGCAGTGGTGTCAGGGATATAGCAGAAATTGAAAGAGTAAGTATTGGTA
AAGTTCTACGGACACTTAGCCAATCAAAATATCAACTTCGAGCACAGCAAAGTCATTATGAAACCCTTGAAGTAGATGAGTTTTGGACTTTTGTTGGTCA
TAAGCAAAATAAACAATGGCTAATTTATGCCTATCATCGAGAAACAGGTGAAATTGTTGCTTATGTATGGGGTAACCGAGATTTAGCCACTGCAAAACGA
CTTAAATTAAAATTGAAGCAGTTAGGTGTAAGCTATACATGTATATCAAGTGACCATTGGGATAGCTTTGTTACGACCTTTAAAGAATGCAAACAGTTGA
TTGGTAAATTTTTCACTGTGGGTATAGAAGGCAATAATTGTCGATTACGGCATCGAATCAGGCGAGGCTTTAGGAGAAGCTGCAACTTCTCCAAAAAGCT
TGAAAATCATTTCAAAGCCTTTGATTTAGTGTTCTTTTATATCAATAATGGATTCGTTTAATGCCAGCATACTTTTTGAAACACCACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
702 bp233 aa60761+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MRITLEIKCPACLSDSIKKNGTKVDGKQNYQCKICRRQFIGDHALSYQGCHSGIKTKILHLMVRGSGVRDIAEIERVSIGKVLRTLSQSKYQLRAQQSHY
ETLEVDEFWTFVGHKQNKQWLIYAYHRETGEIVAYVWGNRDLATAKRLKLKLKQLGVSYTCISSDHWDSFVTTFKECKQLIGKFFTVGIEGNNCRLRHRI
RRGFRRSCNFSKKLENHFKAFDLVFFYINNGFV

 

Blast result :
Comments
ISAlw3 is 92% aa similar to ISPa14.
References
1] Janos Kiss (2019) Direct submission.