ISAlw25

  • Family IS1
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019143 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii ZS207
Acinetobacter lwoffii EK30A plasmid pALWEK1.1
DNA section
IS Length : 788 bp

Ends


IR Length : 25/31

IRL : GGTGGTGTATCAAAAAGTATGCTAAAAAAAAGCAGGTTGAATTTTGATAA
IRR : GGTGGTGTTTTAAAAAGTATGCTGACATTAAATGAAGCCATTATTGATGT

Insertion site


Left flankDirect repeatRight flankDR Length
CTCACCAATA AAAATGTCAAAAACTCTACTATAGCAT0
CCCAGAAGTAAAACTTTTAAAATGTC TAGTTTATGA0

DNA sequence

GGTGGTGTATCAAAAAGTATGCTAAAAAAAAGCAGGTTGAATTTTGATAAAATAGAGAAATGCAAATAACTCTAGAAATCAAATGTCCAACCTGCCTCAG
TGACAGTATAAAGAAAAATGGCATCAAAGTAGATGGGAAACAAAACTACCAATGCAAAGACTGCAAACGTCAGTTTATTGGTGACCATGCTCTGAGCTAT
CTAGGATGTAATTCTGGCATTACTCGTAAAATATTACAGTTAATGGTCAGAGGCAGCGGTATACGAGATATCGCTGAAGTTGAGCGCATTAGTATCGGTA
AAGTCTTACGGACTTTAACTGAATCGGCCTATCAAATTCAGCCTAAACAAAGTCATTATGAATCTCTCGAAGTAGATGAATTCTGGACTTTTGTTGGAAA
TAAAAATAATAAACAATGGCTTATTTACGCCTACCATCGAGAAACAGGTGAGATTGTTGCTTATGTTTGGGGTAAGAGAGATTTAGCTACAGTCCAAAGG
TTGAAGACAAAGCTTAAACAATTAGGTATTCACTACACCCGAATTGCAAGTGATCATTGGGATAGTTTCATCACTGCTTTTAAAAACTGCAAGCAAAGTA
TTGGTAAGTTTTTTACTGTAGGAATTGAAGGTAATAATTGCAAAATAAGGCATCGAATAAGGCGTGGTTTTAGAAGAAGTTGTAATTTCTCCAAAAAGCT
TGAAAACCATTTTAAAGCCTTCGACTTAACCTTCTTTTACATCAATAATGGCTTCATTTAATGTCAGCATACTTTTTAAAACACCACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
702 bp233 aa60761+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MQITLEIKCPTCLSDSIKKNGIKVDGKQNYQCKDCKRQFIGDHALSYLGCNSGITRKILQLMVRGSGIRDIAEVERISIGKVLRTLTESAYQIQPKQSHY
ESLEVDEFWTFVGNKNNKQWLIYAYHRETGEIVAYVWGKRDLATVQRLKTKLKQLGIHYTRIASDHWDSFITAFKNCKQSIGKFFTVGIEGNNCKIRHRI
RRGFRRSCNFSKKLENHFKAFDLTFFYINNGFI

 

Blast result :
Comments
ISAlw25 is 94% similar to ISPa14. Probable transposon composite with DR at each end of the transposon.
References
1] Janos Kiss (2019) Direct submission.