ISAlw7

  • Family IS4
  • Group IS4Sa
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
DNA section
IS Length : 1267 bp

Ends


IR Length : 17/19

IRL : CACTGCTGTCCCATAGTTTGATTTAAATAAAAAACCTGAGTCCAAATCGT
IRR : CACTGCTGTCCCACAATTTTTACAAGAGGAAGCTCATTTAAGCTTCCTCT

Insertion site


Left flankDirect repeatRight flankDR Length
gtccccctttaaaaaagggggGatttcctctcctattaaggacacggtta10

DNA sequence

CACTGCTGTCCCATAGTTTGATTTAAATAAAAAACCTGAGTCCAAATCGTTAAAATATGAGTGCAAACAAACACTTTAACGACCAGGATTCAGGTTTTGT
CACATCAGAATACCGTATTTCATCAGCTTATTAAACCCGTCGTGCGACAGGATTTTGAGCAACTTGCTAAAGTACACCATGTTGGACAGAAATTTAGAGC
GGCTTCAAGATGGGATCAGTTTATTGCCATCTTGATGTCTCAACTTTCCTGCAGGCAAAGTCTGAGAGATATTCAATCCAATCTGGAGTGCCAACAGGAC
AAACTGAGTCATTTCGGAGCAAAGTCTATTCCCCGAAGTACACTGGCACGAATCAATGAGCAGCAGCCTGCTGCCTTGTATCAACAGCTCTTTTACAAGT
TGCTTAAATACTATGAACACTCAAAAGTAGCCCATAAATTTCGCTTTAAGAATCCATTATATTCCCTGGATGCCAGTCATATTGACCTGTCGCTTTCCTT
ATGTGAATGGGCCAAAGTTCACGACTCAAAAGCCAGCATGAAACTCAGCATAGGATTGAATCACAGCAATGATATTCCTGAGTTTATTGCAGTTGAAAAT
GGTAAAGAAAATGACATGTTACAAGGCCGAAAATTCCAGTTTCCCGCTGGCAGCATTGTGGTCTTTGATAAAGGCTATGTCGATTATCAATGGTATGCGA
ATCTAAGCGCTCAAAACGTTAGCTTTGTGACACGTTTTAGACCTAAATCGGTGTATCAGGTGATCCAGCAACATCCCGTGCTTGAATCCAAAGGCATTCT
AAAAGATGAAACCATTCAGCTAAATAGCGCACATGCCCTAAAAAGAAAAGCCCCCGTATTAAGAAGAATTGAATATAGAGATCAGCAAAGTGGCAAGCAC
TTTAGCTTTCTCAGCAATAACTTTCATCTAGCTGCCTCTACCATTGCAGCGATTTACAAAGACCGCTGGAAAGTTGAATTGTTCTTTAAAGCGATTAAAC
AGAACCTGAAATTAAAAGCCTTTTTAGGCCGAAGCAAGAACGCCATTCAGACGCAAATCTGGATTGCGATGATCGCCTATTTACTGGTAAGTTTCGCTCA
ACATTTAGGGAAAAAAGGCTGGACAGTTCAGCGCTTACTCAGAATAATTCAAGTGAATTTATTTGAAATAAAAACCTTAAAAGCGTTATTTTCACCCGAT
AAAGTCCCCATCAAACAAGAGGAAGCTTAAATGAGCTTCCTCTTGTAAAAATTGTGGGACAGCAGTG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1134 bp377 aa971230+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSHQNTVFHQLIKPVVRQDFEQLAKVHHVGQKFRAASRWDQFIAILMSQLSCRQSLRDIQSNLECQQDKLSHFGAKSIPRSTLARINEQQPAALYQQLFY
KLLKYYEHSKVAHKFRFKNPLYSLDASHIDLSLSLCEWAKVHDSKASMKLSIGLNHSNDIPEFIAVENGKENDMLQGRKFQFPAGSIVVFDKGYVDYQWY
ANLSAQNVSFVTRFRPKSVYQVIQQHPVLESKGILKDETIQLNSAHALKRKAPVLRRIEYRDQQSGKHFSFLSNNFHLAASTIAAIYKDRWKVELFFKAI
KQNLKLKAFLGRSKNAIQTQIWIAMIAYLLVSFAQHLGKKGWTVQRLLRIIQVNLFEIKTLKALFSPDKVPIKQEEA*

 

Blast result :
Comments
ISAlw7 is 98% aa similar to ISAbe18.
References
1] Janos Kiss (2019) Direct submission.