ISAlw8

  • Family IS4
  • Group IS50
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
Acinetobacter lwoffii ZS207
DNA section
IS Length : 1370 bp

Ends


IR Length : 16

IRL : CATAGGTATCTACACAATTCCTGAACTTTGCGTTAAATTGAAGAGCATGC
IRR : CATAGGTATCTACACATCTATGAGATACCTAATGCCATTGTGGCTATCTC

Insertion site


Left flankDirect repeatRight flankDR Length
GCTTCTCATCTCCCAAAGGGAGAGGGAGCAC9

DNA sequence

CATAGGTATCTACACAATTCCTGAACTTTGCGTTAAATTGAAGAGCATGCTCTTCAATTTAACATCTCTGGCCTGGATCAGCGTCTTGTCAAGCGCTATA
ACAGCCTTGTAAAGCTCAATATGAACCCTCTTGCTTCACTTGCTCCGGCAATCAAAGACCTGGCTTCTGCCCAAAAGTCGAGTTTCGCAACCACACAAGC
GGTCTGGCGATTCCTGAATAATGACAAAATCTCTTTTAGTCAGTTAAACCAGCCAATTGAACATCTTGCATGTGAACAGATCAAGGCATCACCGCATCAA
TATGCATTGATTGTTCATGACTGGTCTCAGCTACAGTATGTGAAACACCATCATAAAATTCAGCGCCTGCAAAGAACCCATCAATATGATTCAGGCTATG
AATTGCAAAGCAGTCTGCTGGTTGATGCAGCCTCGGGACTACCTATTGCGCCACTGGCGCAGACACTATCAGATGCCTCAGGCTGCTATTCCACATTCAG
TCAACACTCTGCTGGGCGCAAATCTCATCTAGATTCACTTACCGAACAAATCAAAGTGATTGAACAATATCCCATTGAGAAAACATGTGTTCATATCATT
GATCGTGAAGGTGACTCCATTGCCCACCTAAGGGAAATGAGCAGCCAGGGTTTTAAATGGCTGATTCGGGCGAAAGAAGGCCATCGAATTGAGCATCAGG
GCAAAACATGCAAAGTTGCAGAAGCCGCAGAACGAGTAGAAACGCAGCAGGTCCAGCCGATTGCCTATAAAGGAAACCGGCATATGTTGCATGTGGGAGA
AACTGCTATCCGGATAACACGTGCAGCAAAACCGAAGAGAAATGACGATTCAGGCCAACGGGTTGCTCCCCAGCCAGGGAGTGCGATTGAAGCCAGATTA
ATTGTTGCCGTAGTGAAAGATGATCAGGATAAGACCGTCGCAAGATGGTCACTAATCAGCAATGTTCCATCAGAGATTACTACGGTAGAGATGACGACCT
GGTATTACTGGCGCTGGACAATTGAATGCTATTTCAAGCTGCTCAAGCAGGCAGGTCATGATATTGAAGCATGGCTTCAGACCAGACCTGAAGCCATTTT
AAGGCGGTTACTGATTAGCTGTATGGCTTGTGTTTTAACTTGGCGAATCCAGCGTTCTGAAGATGAACACCATCAGAAAATTCGTGTATTTCTCACCCGT
CTTTCAGGTCGGCAGCAGAAAAGAGGTAGGTTGGAAAGTGCACCTGCCTTATTGGCAGGGCTTTCGATTTTACTGAACACTCTTCAACTGCTCTCGGAAT
ATTCAATAGATGAACTCAATGAGATAGCCACAATGGCATTAGGTATCTCATAGATGTGTAGATACCTATG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1233 bp377 aa1211353+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNPLASLAPAIKDLASAQKSSFATTQAVWRFLNNDKISFSQLNQPIEHLACEQIKASPHQYALIVHDWSQLQYVKHHHKIQRLQRTHQYDSGYELQSSLL
VDAASGLPIAPLAQTLSDASGCYSTFSQHSAGRKSHLDSLTEQIKVIEQYPIEKTCVHIIDREGDSIAHLREMSSQGFKWLIRAKEGHRIEHQGKTCKVA
EAAERVETQQVQPIAYKGNRHMLHVGETAIRITRAAKPKRNDDSGQRVAPQPGSAIEARLIVAVVKDDQDKTVARWSLISNVPSEITTVEMTTWYYWRWT
IECYFKLLKQAGHDIEAWLQTRPEAILRRLLISCMACVLTWRIQRSEDEHHQKIRVFLTRLSGRQQKRGRLESAPALLAGLSILLNTLQLLSEYSIDELN
EIATMALGIS

 

Blast result :
Comments
ISAlw8 is 58% aa similar to ISPpr4.
References
1] Janos Kiss (2019) Direct submission.