ISAlw10

  • Family IS4
  • Group IS4
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019143.1 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
Acinetobacter lwoffii ZS207
Acinetobacter lwoffii NCTC5866
DNA section
IS Length : 1389 bp

Ends


IR Length : 18

IRL : TAATGCCAGTCAGTTAAGCAAAAAAAGTTAAAATGCTGTAAAAAGAGCGT
IRR : TAATGCCAGTCAGTTAAGAAATTGACTGGCATTTTCTTGGATATTTTTGT

Insertion site


Left flankDirect repeatRight flankDR Length
gacccagcaataaaaaagcctctagagatagaggcttttttatatttaaaac12
tgctctgctattaaaaagccctcaattgcatggggcttttttatgtttgagt12
CTGAAGATATAAAAAAGCCCTCAGTTGAGGGCTTTTTTATATGCATT11
ATAGACATAAAAAAAGCCTCTACGACTAGGGGCTTTTTTTATTTATAA12
TAATAAATATCAAAAAAGCTCAATTGAGGGCTTTTTTTAGGCTGGTAG12
TTCTCAAAACAAAAAGCCCGCTTTACGCAGGCTTTTTATCCGAAAAA11
TCTAGAATGAAAAAAGCCCTCTAATGAGGGCTTTTTCTTTTAAAAA10

DNA sequence

TAATGCCAGTCAGTTAAGCAAAAAAAGTTAAAATGCTGTAAAAAGAGCGTATGTAAATACGCTCTTTTTTTATGAATTTATCTCAGAATCTAGATTTAAC
ATTAAAACAAACCCTACCTTCACTTTCACAATTCAGTGAATTGATTGATTTAAACTGGATTGAAGATTGCTTAGACCAAACAGGTAAAGCATCAATTCGA
AAAAGAAAACTGCCTGCTGAACATGTTGTTTGGCTGGTAATCGGACTTGCTCTATTTCGAAATCAACCGATTTGGTATGTGGTTCAACAATTGCAACTTG
TTTTCGGTACGGCAGAATACTGTGTACCGAGTGCATCCGTACAAGCAAGACAACGCTTAGGCTTAGAACCCATGAGTGCTTTATTTTCGACATTAAGTCA
GGCATGGTTTAAAGACTCACAACAACAATATAGCAACTTTCACGGTCTATGCGTTTGTGCTGTAGATGGTGTGGTTTGGTCTATGCCTCATACAGAAGAA
AACTTTAAGCACTTTGGTTCATCCAAAGGCAAAACAGCAGCTGCACCTTACCCACAAGTTAGAGCGACTTGCCTGGTGAATACCAATACCCATGAAATGA
TTGATGCCCAAATGGGCAGTATGGATCAAGGTGAATTAACCTTAGCCAGTCAATTAAAAGCACCAGTTCGCAGTATTACCCTATTTGATCGTGCTTACTT
CTCTGCTGATTTTTTAGTGAGCTGGCAATCTCAGGCAGAAGAGAGTCATTGGTTGATGCGAGCAAAGGACAACCTGCGTTATGAAGTGATTCATCATAAT
GCGGCCCATGACTTTCAGATCAAAATGCCTGTTTCAGCAAGAGCAAAAAAGATAAATCCGTCATTGGGTGACTATTGGGAAGCACGTTTAATTGAAGTTG
AATATGCAGGAAAAATAAGACGTTACATTACATCATTAACAGATTCTAAAGTTTATCCATTCAAAGACCTTGCAATGCTTTATATCCAGCGTTGGGAAAT
AGAAATGTGTTATCGGGAAATTAAAAGTGATTTACAGGATGCAAGGATTTTAAGAAGCAAACAACCTGATTTGGTCTATCAAGAATTGTGGGGGGTATTT
ATTGCATATAATATCTTAAGAAGACAGATGAGGTTTATCGCTGAACATGCAAAGGTGAGTCCTTTAAGGATCAGTTTCCATATTGCATCTATGAGTATTA
TCAATATCTTAAGGCACACACCTTTAGAATCAGCAGGAAACCTACCCAAACATTTAGCGCAATTATTTGAACAATCTAAAATATTTGTATTACCTGAAAA
AAGGCAAAGGCAATGTCCGCGAGTAGTGAAAATTAAAGCACAAAAATATCCAAGAAAATGCCAGTCAATTTCTTAACTGACTGGCATTA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1305 bp434 aa721376+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNLSQNLDLTLKQTLPSLSQFSELIDLNWIEDCLDQTGKASIRKRKLPAEHVVWLVIGLALFRNQPIWYVVQQLQLVFGTAEYCVPSASVQARQRLGLEP
MSALFSTLSQAWFKDSQQQYSNFHGLCVCAVDGVVWSMPHTEENFKHFGSSKGKTAAAPYPQVRATCLVNTNTHEMIDAQMGSMDQGELTLASQLKAPVR
SITLFDRAYFSADFLVSWQSQAEESHWLMRAKDNLRYEVIHHNAAHDFQIKMPVSARAKKINPSLGDYWEARLIEVEYAGKIRRYITSLTDSKVYPFKDL
AMLYIQRWEIEMCYREIKSDLQDARILRSKQPDLVYQELWGVFIAYNILRRQMRFIAEHAKVSPLRISFHIASMSIINILRHTPLESAGNLPKHLAQLFE
QSKIFVLPEKRQRQCPRVVKIKAQKYPRKCQSIS

 

Blast result :
Comments
ISAlw10 77% similar to ISAlw9.
A. lwoffii NCTC5866 (LR215977.1), A. johnsonii M19 (CP037424.1) and Acinetobacter sp. NCu2D-2 (CP015594.1) carry 7, 4 and 14 copies of ISAlw10 (99% similar to the prototype).
References
1] Janos Kiss (2019) Direct submission.