ISAlw11

  • Family IS5
  • Group IS427
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
DNA section
IS Length : 857 bp

Ends


IR Length : 16

IRL : GGGTCTGTTGACATTTACTGTTCAAAAAAATAGCGAGAAAGTAAAATTTA
IRR : GGGTCTGTTGACATTTCAAGTATAGAATTTACCCGATAAAGGTAGCCAAA

Insertion site


Left flankDirect repeatRight flankDR Length
tatttaaaaaagattagtcttaatagtttttgtctttatttg2
tttaattgatgtgtataactTAatattctgagtccattctca2
cggattaaaaaacaggatatTAtttattttctctaagtattt2

DNA sequence

GGGTCTGTTGACATTTACTGTTCAAAAAAATAGCGAGAAAGTAAAATTTAATCGCCAAACTAAATTTACTTCTCGCTATGCCTCGTACAATGCTGAATGA
TCAACACTGGTCTAAGTTACTTTCTATTTTCCGAAATTTTGATATCTATTTCAAATCTAATTTGAGAAATTTTGTCGAAGCAATACTTTATAGAATAAGA
ACAGGCTGCCCATGGCGTGATTTGCCTAAAGAATTTGGTTCGTATAACTCAATCTTTAAAAAATATAATCGTTGGTGTAAAAATGATAAGTTAATGAAAA
TATTTAAATTAATTTCTTCAAGTGCTGATATGGAATGGGTTTTTATTGATGGTAGTCATGTTCGGGCACACCAACATTCTGCTGGAATAAAAGATCAGGA
TATTTCTAAAAGCATTGGTGGAAATAGTTCTAAAATACACTTAGCTGTTGATGCGGATGGCAATCCAATCGAAATTATTATCTCCGATGGAACGATACAT
GATGTCAAGATTGCTCCCAAAATGATTGAAAAACTTGATTTGAGTGAAACGGAAGTATGTTGTGCAGACAAAGGATATGACTCTGAATCATTAAGAGAAC
AAATATCTGCGAAAAAAACTAAAGCGAATATTCCAAGAAAATCAAATACTCAGTCAAATAATGATCATATGGATTGGTATTTATATAAAATCAGACACTT
AGTTGAGAATGCATTTTGTAGGTTAAAGCAGTTCAGAGGAATAGCAACACGATATGATAAGCTAAAGTGTAGCTATGAGGGGGCAGTTGCATTAGCTTGT
ATATTTATTTGGCTACCTTTATCGGGTAAATTCTATACTTGAAATGTCAACAGACCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
765 bp254 aa78842+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MPRTMLNDQHWSKLLSIFRNFDIYFKSNLRNFVEAILYRIRTGCPWRDLPKEFGSYNSIFKKYNRWCKNDKLMKIFKLISSSADMEWVFIDGSHVRAHQH
SAGIKDQDISKSIGGNSSKIHLAVDADGNPIEIIISDGTIHDVKIAPKMIEKLDLSETEVCCADKGYDSESLREQISAKKTKANIPRKSNTQSNNDHMDW
YLYKIRHLVENAFCRLKQFRGIATRYDKLKCSYEGAVALACIFIWLPLSGKFYT

 

Blast result :
Comments
All IRs found in A. lwoffii M2a genome are flanked by TA.
ISAlw11 is 85% aa similar to ISAbe13.
References
1] Janos Kiss (2019) Direct submission.