ISAlw14

  • Family IS5
  • Group ISL2
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
DNA section
IS Length : 916 bp

Ends


IR Length : 19

IRL : AGATCTCTTTCATAAATCAAAAAACGATCTTCTTTTTGGTTAATATTTGC
IRR : AGACCTCTTTCATAAATCATTTTTTGCTCAGTTCCAAGTTGTAGATTCCA

Insertion site


Left flankDirect repeatRight flankDR Length
tttttattttaattttgataagtgttatattaattttggtttg3

DNA sequence

AGATCTCTTTCATAAATCAAAAAACGATCTTCTTTTTGGTTAATATTTGCACTCCGGATTTCTTGGCATTCGTGCATAATCTGCGGATGAAATACATCGA
TTCAAACAAGCTTTCTGATCCTCAGTTCAAGCGATACACAGGCATCTCATGGTCAACTTTCTATTTGATGGTTGAGCAATTGAAGAAACATGTCCCTGCC
AAAGGCAGACCGCCCAAGTTAAGCCTGGAAGACCAGGTTCTGCTCTGTCTGAGCTATTGGCGGGAATACCGAACCTTATTTCACGTTGCGACGAGCTACG
GGGTTTCAGAGCCCACAGCCTCAAGAATTGTCCGTCATGTTGAAGACTGCCTGATTCGGTCCAATCTCTTTAATTTACCCAAAGATTTACCCGAGGGCGA
AGGCATCGATTGGAATGTTGTGATCGTGGATGCCACAGAAATTCCAATCCAAAGGCCTAAAAAAACAGAAGAAAAGCTATAGCGGCAAGAAAAAGACCCA
CACTTTCAAAGTACAGGCCATGATTCACTACAAAACTCAGCAAATTCTGAGTTTATGTACCAGTCGCGGTGCAGTGCATGATTTCGAGTTGTTCAAACGC
AATTTAAACCAGATTCCTTTTGGGGCTTTTATCCTTGCAGATAAAGGCTATCAGGGGATTTATGTGTTGTATCCGAATAGCCTGTTGCCATTAAAAGCCA
AAAGACACTGTAAATTGGATCCTGAATTGAAAATCTATAATCAAGAAATCAATAAAAGAAGAATCGGAATTGAGCATGTATTTGGCAGCCTGAAAACCTT
CAAAATCCTTGCTGAGCGTTATCGAAATAGAGGTAAAAGGCTTGGTTTGAGATTCAATTTAATCGCTGGAATCTACAACTTGGAACTGAGCAAAAAATGA
TTTATGAAAGAGGTCT
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
396 bp131 aa87482+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MKYIDSNKLSDPQFKRYTGISWSTFYLMVEQLKKHVPAKGRPPKLSLEDQVLLCLSYWREYRTLFHVATSYGVSEPTASRIVRHVEDCLIRSNLFNLPKD
LPEGEGIDWNVVIVDATEIPIQRPKKTEEKL

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
477 bp158 aa424900+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

SWMPQKFQSKGLKKQKKSYSGKKKTHTFKVQAMIHYKTQQILSLCTSRGAVHDFELFKRNLNQIPFGAFILADKGYQGIYVLYPNSLLPLKAKRHCKLDP
ELKIYNQEINKRRIGIEHVFGSLKTFKILAERYRNRGKRLGLRFNLIAGIYNLELSKK

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
814 bp270 aa87900+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKYIDSNKLSDPQFKRYTGISWSTFYLMVEQLKKHVPAKGRPPKLSLEDQVLLCLSYWREYRTLFHVATSYGVSEPTASRIVRHVEDCLIRSNLFNLPKD
LPEGEGIDWNVVIVDATEIPIQRPKKQKKSYSGKKKTHTFKVQAMIHYKTQQILSLCTSRGAVHDFELFKRNLNQIPFGAFILADKGYQGIYVLYPNSLL
PLKAKRHCKLDPELKIYNQEINKRRIGIEHVFGSLKTFKILAERYRNRGKRLGLRFNLIAGIYNLELSKK

 

Blast result :Comments : The third ORF is a putative ORFAB transposase reconstructed in silico by a possible +1 frameshift.
Comments
ISAlw14 is 62% aa similar to ISCaa3.
The third ORF is the putative ORFAB transposase reconstructed in silico by a possible +1 frameshift.
References
1] Janos Kiss (2019) Direct submission.