ISAlw32

  • Family IS5
  • Group ISL2
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019143.1 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii ZS207
Acinetobacter lwoffii NCTC5866
DNA section
IS Length : 916 bp

Ends


IR Length : 19

IRL : AGGCCTCTTTCATAAATCAAAAAACAAACAGTCTCTTGCTGATTATTTGT
IRR : AGACTTATTTCATAAGTCATTTTTTACTCAGTTCCATATTGTAGATTCCA

Insertion site


Left flankDirect repeatRight flankDR Length
ttctagttacagggaagtagagtgaatgctctataaaaagaaa3
tctatgagtaagcctattactttaaatcattataaaattttat3

DNA sequence

AGGCCTCTTTCATAAATCAAAAAACAAACAGTCTCTTGCTGATTATTTGTACCGAAGAATTTTAAATATTCATGCATAATCTGCGGATGAAATACATCGA
TTCAAAGAAGCTTTCTGAAACACAGTTTAAGCGATACACAGGCATCTCATGGTCAACCTTTGATTTAATGGTGGAACAACTGAAAATGCATGTTCCTGCT
AAAGGTAGACCCACCAAATTAAGCATAGAAGATCAAATCCTTCTGTGCTTAAGTTATTGGCGTGAATATCGAACATTGTTCCATGTTGCAACTAGTTATG
GTGTGTCAGAGCCGACTGCTTCAAGAATTGTCCGTCATGTAGAGGACTGCCTGATCAAGTCTAATCTATTTAATTTACCGAAGCATTTACCTAAGGGCGA
AGGCATCGACTGGAACGTGGTGATTGTTGATGCCACAGAAATTCCAATACAAAGACCTAAAAAAACAGAAGAAAAGCTATAGTGGCAAAAAGAAGGCACA
TACTTTCAAAGTACAGGCCATCATTCATTATAGAACTCAACAAATTCTGAGTTTATGCACGAGTCGTGGTGCTGTACATGATTTCGCACTCTTCAAACGA
AACTTGCATCAGATTCCGGCAGGTGCCTTTATCCTTGCAGATAAAGGCTATCAAGGGATTTACTCAGTGTATCCAAATAGCCTATTGCCATTAAAAGCAA
AAAAGCGCTGTAAATTGAATCCTGAACTAAAAATCTATAATCAAGAAATCAACAAAAGAAGAATTGGGATTGAGCATGTATTTGGCAGTTTAAAAACCTT
CAAAATCCTTGCTGAGCGATATCGTAATCGAGGAAAAAGACTGGGTTTAAGATTCAATTTAATTGCTGGAATCTACAATATGGAACTGAGTAAAAAATGA
CTTATGAAATAAGTCT
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
411 bp136 aa72482+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MHNLRMKYIDSKKLSETQFKRYTGISWSTFDLMVEQLKMHVPAKGRPTKLSIEDQILLCLSYWREYRTLFHVATSYGVSEPTASRIVRHVEDCLIKSNLF
NLPKHLPKGEGIDWNVVIVDATEIPIQRPKKTEEKL

 

Blast result :Comments : First part of transposase.
ORF 2
LengthBeginEndStrandFusion ORF
477 bp158 aa424900+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

LLMPQKFQYKDLKKQKKSYSGKKKAHTFKVQAIIHYRTQQILSLCTSRGAVHDFALFKRNLHQIPAGAFILADKGYQGIYSVYPNSLLPLKAKKRCKLNP
ELKIYNQEINKRRIGIEHVFGSLKTFKILAERYRNRGKRLGLRFNLIAGIYNMELSKK

 

Blast result :Comments : Second part of transposase.
ORF 3
LengthBeginEndStrandFusion ORF
829 bp275 aa72900+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MHNLRMKYIDSKKLSETQFKRYTGISWSTFDLMVEQLKMHVPAKGRPTKLSIEDQILLCLSYWREYRTLFHVATSYGVSEPTASRIVRHVEDCLIKSNLF
NLPKHLPKGEGIDWNVVIVDATEIPIQRPKKQKKSYSGKKKAHTFKVQAIIHYRTQQILSLCTSRGAVHDFALFKRNLHQIPAGAFILADKGYQGIYSVY
PNSLLPLKAKKRCKLNPELKIYNQEINKRRIGIEHVFGSLKTFKILAERYRNRGKRLGLRFNLIAGIYNMELSKK

 

Blast result :
Comments
ISAlw32 is 83% similar to ISAlw14.
The third ORF is the putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
A. lwoffii NCTC5866 carries a single copy of ISAlw32.
References
1] Janos Kiss (2019) Direct submission.