ISAlw16

  • Family IS66
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
DNA section
IS Length : 2512 bp

Ends


IR Length : 19

IRL : GTAAGCGTCCGCTGAACACACCTTATGAATTCATCCTATAAGCCTTAATT
IRR : GTAAGCGTCCGCTGAACCCCATGCCTATTTTTTAATTCGGTTCAGGTTTC

Insertion site


Left flankDirect repeatRight flankDR Length
aaagaaaacgaatagccaatcgaacaatgaccatatggactggtattt8
aaatttcatgcatttatcatgaaatatcattatatttttcacttattt8
tttttctgaaaatataatagactggttttcactcaaagttccacttaa8
tttataagctttgttacaaagttaatccatctaattaaatgcgcttta8

DNA sequence

GTAAGCGTCCGCTGAACACACCTTATGAATTCATCCTATAAGCCTTAATTTAGTCCCCACTTAAAAACAAGTGGGGACTAAAATTTATGACTACAAATCA
CCAGACATCCATCGCATCTCTTGCGAAAAAACGAAGAACATACAGTGCTGAATTTAAACAGCAGATCGTTCAGGCTTGTAAAGCACCAGACGTTTCAATT
GCTTCAGTCGCTTTGCAACATGGATTGAATACAAATCTTGTATCCAAATGGATTCGCTTAATTGATGCTAAGCCAGGGAATGATCGCTCACCACTACCGA
ATAAACCTGCATTTATTGCCTTATCTTGCTCTGCACCATTAGATCCTACTCCTACTGACATGTTAAAGGTTCAAATTACTTTACCCCACTCAAAAGCAGA
AATTGGCTTGAAATGGCAAGTATCAGAAATATCTGCTTTAGCAGAATTACTCAAGGCACTTGCAACATGATCCGCATTGATGAAATCTGGTTGTCTACTC
AGCCCATGGACATGCGTGCAGGTATGGATACGACCATGGCTCAGGTGGTGAGAGCCTTTGGCTACATCAAACCGCATTGTGCTTACCTGTTCTGTAATAA
ACGTGGCCATCGCATGAAAGTACTGGTGCATGATGGACTGGGCATCTGGCTGTGTGCCCGGCGGCTGGAACAGGGCAAATTTCACTGGGCTCAAGTTCAC
CAGGGTGAAAGCGTAGCTCTCAGCCCGGAACAGTTACAGGCACTGATCCAGGGTTTGCCCTGGCAGCGCATTGGACGACAGCAGGTGGTGACGATGCTTT
AAACCAAGCTGTTCCATTCTGCTATTCTCCAAACGTTCTATTTCATTCTTCTCATGACCTCAGGCATACTGCGGTCATGAATACGCTGCCTGACTTAAGC
CAACTGACCCATGAACAACTGCTGGAATTTACCAGGCAGTTGGCGCTGCAGCATCAGTCTCTGGCACAATCAAATCAAGAATTAGAAAAATCAAACCAGC
AATTGGATGCCAAAGTTCAGCATCTTTCTATTCTCAATCAAAAATACGAGCATGAACTGGCGCTGTTTAAAAAGCACAAATTCGGCAGTAAAAACGAACA
TCTCACCGCAAAACAAATCCATCTCTGGGATGAAGCGGTCGAAGAAGATATCGCAGCCGTTGATCTGGAACTGGAACGGCTGAATGCAGATAAAACCGAT
GCAGCGACACACAAAGCCAAAGCAAATAAACCTAAACGTCGACCACTGCCAGATCATCTACACACCATCCGTATTGAGCATGAACCTGCATCAACCCAAT
GCGCTTGTGGCTGCCAACTCCGTCGTATCGGCGAAGATGTCAGTGAAAAACTGCATTTCAGACCGGCACAGTTCTATAAGGAACAGCATGTGCGTGGTAA
ATGGGTCTGTGATCAGTGTGACACCCTGACTCAGCAAGCGATGCCTGCCTATGTAATTGATAAAGGCATTGCTTCACCTGAATTGCTCAGCCATGTGCTG
GTATCGAAATATGCCGATCATTTGCCGCTGTACCGTCAACGTCTGATCTATCAGCGGGCGGGAATCGAACTTTCTAGATCAACTTTATCTGACTGGATAG
GTCGCTGCGGTGTAGAACTGGAACCTCTGGCCAATGCCTTAAAACAGGTGGTGCTGCAACAGCGGGTGATCCATGCCGATGAAACGCCGGTCACCATCAT
GCGGATGGGTGATGATGAGAAAAAACCGAAAAAAGGTTATGTCTGGGCCTATGCCACTACACAGTACAATCCAGTTCAGGCAGTGATCTATGACTTTCAG
GATAGTCGTTCAGGCCAGCATGCTGAAGCGTTCTTGAAAGGCTGGCAGGGCAATCTAGTCTGTGATGATTACAGTGGTTATAAAGCACGCTTTAAATCAG
GTCAGGTCATAGAGGTGGGCTGCATGGCCCATGCACGTCGTAAATTCCATGAACTGCATGTGACCGGGAAAAGTCAGGTCGCTGAACAGGCATTGGTGCT
GATTCAGAAACTGTATGCGATAGAAGTAGAACTCAGGAAAAAGACCGATGGTACAGCAGAACAGCGCCGCGAATACCGACAACAGCATAGTCAACCAGTG
ATGCAACAACTGTATGAATGGCTCAACCAACATCATCTGACAGTGCCATCGAGTTCTCCCACCGCCAAGGCGATCAATTACAGCCTAAAACGTTGGCAGG
CACTCTGCCGCTATCTGGATGATGGTAATTTGCCTATAGATAATAACTGGATTGAAAATCAGATGCGTCCCTGGGCGTTGGGGCGCAAGAACTGGCTGTT
TGCTGGCTCGCTGCGCAGTGGTCAGCGAGCGGCAAACATCATGACGTTAATCCAGTCAGCAAAGCTGAATGGGCTGGATCCGTATGCCTATTTAAGTGAT
GTGCTGAAAAGGCTGCCGACACATAAAGTGACCCAGATTGAAGAGTTACTGCCACACTGCTGGAAACCTGAACCGAATTAAAAAATAGGCATGGGGTTCA
GCGGACGCTTAC
Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
384 bp127 aa87470+No
ORF function : Accessory Gene
AG : IS66 TnpA

ORF sequence :

MTTNHQTSIASLAKKRRTYSAEFKQQIVQACKAPDVSIASVALQHGLNTNLVSKWIRLIDAKPGNDRSPLPNKPAFIALSCSAPLDPTPTDMLKVQITLP
HSKAEIGLKWQVSEISALAELLKALAT

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
390 bp129 aa413802+No
ORF function : Accessory Gene
AG : IS66 TnpB

ORF sequence :

MASIRNICFSRITQGTCNMIRIDEIWLSTQPMDMRAGMDTTMAQVVRAFGYIKPHCAYLFCNKRGHRMKVLVHDGLGIWLCARRLEQGKFHWAQVHQGES
VALSPEQLQALIQGLPWQRIGRQQVVTML

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1605 bp534 aa8772481+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNTLPDLSQLTHEQLLEFTRQLALQHQSLAQSNQELEKSNQQLDAKVQHLSILNQKYEHELALFKKHKFGSKNEHLTAKQIHLWDEAVEEDIAAVDLELE
RLNADKTDAATHKAKANKPKRRPLPDHLHTIRIEHEPASTQCACGCQLRRIGEDVSEKLHFRPAQFYKEQHVRGKWVCDQCDTLTQQAMPAYVIDKGIAS
PELLSHVLVSKYADHLPLYRQRLIYQRAGIELSRSTLSDWIGRCGVELEPLANALKQVVLQQRVIHADETPVTIMRMGDDEKKPKKGYVWAYATTQYNPV
QAVIYDFQDSRSGQHAEAFLKGWQGNLVCDDYSGYKARFKSGQVIEVGCMAHARRKFHELHVTGKSQVAEQALVLIQKLYAIEVELRKKTDGTAEQRREY
RQQHSQPVMQQLYEWLNQHHLTVPSSSPTAKAINYSLKRWQALCRYLDDGNLPIDNNWIENQMRPWALGRKNWLFAGSLRSGQRAANIMTLIQSAKLNGL
DPYAYLSDVLKRLPTHKVTQIEELLPHCWKPEPN

 

Blast result :
Comments
ISAlw16 is 95% aa (transposase)similar to ISAba49.
ISAlw16 has at least four slightly different copies in A. lwoffii M2a. The strain also contains several further IS copies that are related to ISAlw16, but are closer to ISAba46 or ISAba25. The prototype of ISAlw16 was defined according to the copy located on plasmid pAVAci127 of M2a.
References
1] Janos Kiss (2019) Direct submission.