ISAlw34

  • Family IS66
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019143.1 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii ZS207 plasmid pmZS
DNA section
IS Length : 2511 bp

Ends


IR Length : 16

IRL : GTAAGCGTCCGCTGAACACACCTTATGAATTCATCCTATAAGCCTTAATT
IRR : GTAAGCGTCCGCTGAATCCCATACCAATTTTTAATTCGATTTAGGTTTCC

Insertion site


Left flankDirect repeatRight flankDR Length
gagctttgatgcggacattgaattactcgcattgcatagagatagata8

DNA sequence

GTAAGCGTCCGCTGAACACACCTTATGAATTCATCCTATAAGCCTTAATTTAGTCCCCACTTGAAAACAAGTGGGGACTAAAATTTATGACTACAAATCA
CCAGACATCCATCGCATCTCTTGCGAAAAAACGAAGAACATACAGTGCTGAATTTAAACAGCAGATCGTTCAGGCTTGTAAAGCACCAGACGTTTCAATT
GCTTCGGTCGCTTTGCAACATGGATTGAATACAAATCTTGTATCCAAATGGATTCGCTTAATTGATGGTAAGCCAGGGAATGATCGCTCACCACTACCGA
ATAAACCTGCATTTATTGCCTTATCTTGCTCTGCACCATTAGATCCTACTCCTACTGACATGTTAACGGTTCAAATTACTTTACCCCACTCAAAAGCAGA
AATTGGCTTGAAATGGCAAGTATCAGAAATATCTGCTTTAGCAGAATTACTCAAGGCACTTGCAACATGATCCGCATTGATGAAATCTGGCTTTCTACCC
AACCTCTGGATATGCGAGCAGGGATGGATACTATCATGGCTCAGGTGGTGAGAGCCTTTGGCTACATTAAACCGCATTGTGCTTACCTGTTCTGTAATAA
ACGTGGCCATCGCATGAAAGTGCTGGTACATGATGGACTGGGCATCTGGCTGTGTACCCGGCGGCTGGAACAGGGAAAATTCCACTGGGCTAAAGTTCAC
CAGGGTGAAAACGTAGCTCTCAGTCCAGAACAGTTACAGGCACTAATTCAGGGTTTGCCCTGGCAGCGCATTGGACGACAGCAAGTGGTAACAATGCTCT
AAACTAGGCTGCTACATTCTGCTATTCTCCAAACGTTCTATTTCCTCTGCGTCATGACCTCAGGCATACTGCGGTCATGAAAATGCTGCCTGATTTAAGC
CAACTGACCCATGAACAACTGCTGGAATTTACCCGGCAGTTGGCGATGCAGCATCAGTCTCTGGCACAATCAAATCAAGAATTAGAAAAATCAAACCAGC
AATTGGATGCCAAAGTTCAGCATCTTTCTATTCTAAATCAAAAATACGAGCATGAACTGGCGCTGTTTAAAAATCATAAATTCGGCAGTAAAAACGAACA
TCTTACCGCAAAACAAATCCATCTATGGGACGAAGCGGTCGAAGAAGATATCGCAGCCGTTGATCTAGAATTAGAACGATTAAATGCAGATAAAACCGAT
GCAGTGACACAGAATGCCACAGTCAACAAACCTAAACGTCGACTGCTGCCAGATCATCTACACACCATCCGTATTGAGCATGAACCTGCATCAACCCAAT
GCAGTTGTGGCTGCCAGTTACGTCGTATCGGCGAAGATATCAGTGAAAAACTGCATTTCAGACCGGCACAGTTCTACAAGGAACAGCATGTCCGTGGCAA
ATGGGTCTGTGATCAGTGCGACACTCTGACTCAGCAAGCGATGCCTGCCTATGTGATTGATAAAGGCATTGCTTCACCTGAATTGCTCAGCCATGTGCTG
GTATCGAAGTATGCCGATCATTTGCCGCTGTACCGTCAGCGCCTGATCTATCAGCGGGCGGGCATTGATCTGTCCAGATCTACTTTATCTGACTGGATTG
GTCGCTGCGGTGTGGAACTGGAACCTCTGGCCAATGCCTTAAAACAGGTGGTGCTGCAACAGCGGGTGATCCATGCCGATGAAACGCCGGTCACCATCAT
GCGGATGGGTGATGATGAGAAAAAACCGAAGAAAGGTTATGTCTGGGCCTATGCCACGACACAGTACAATCCAGTTCAGGCAGTGATCTATGACTTTCAG
GATAGTCGTTCAGGTCAGCATGCTGAAGCGTTCCTGAATGGCTGGCAGGGCTATCTAGTCTGTGATGATTACAGTGGTTATAAAGCACGCTTTAAATCAG
GCCAGGTCATTGAGGTGGGCTGCATGGCCCATGCACGTCGTAAATTCCATGAACTGCATGTGACCGGGAAAAGTCAGGTCGCTGAACAGGCATTGGTGCT
GATTCAGAAACTGTATGCGATAGAAGCAGAACTCAGGAAAAAGACCGATGGTACAGCAGAAGACCGCCGCGAATACCGACAACAGCATAGTCAACCAGTG
ATGCAACAACTATATGAATGGCTCAACCAACATCATCTGACAGTGCCATCGAGTTCTCCCACCGCCAAGGCGATCAATTACACTCTGAAGCGTTGGTCAG
CTTTAAGCCGCTATCTGGATGATGGCAATCTACCGATTTGCAATAATTGGGTCGAGAATCAGATGCGTCCCTGGGCGTTGGGGCGCAAGAACTGGCTGTT
TGCAGGTTCGCTGCGCAGTGGTCAGCGAGCGGCAAACATCATGACGTTAATCCAGTCAGCAAAGCTGAATGGGCTGGATCCGTATGCTTATTTAAGTGAT
GTGCTGAAAAGGCTGCCGACACATAAAGTGACCCAGATTGAAGAGTTACTGCCACACTGCTGGAAACCTAAATCGAATTAAAAATTGGTATGGGATTCAG
CGGACGCTTAC
Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
384 bp127 aa87470+No
ORF function : Accessory Gene
AG : IS66 TnpA

ORF sequence :

MTTNHQTSIASLAKKRRTYSAEFKQQIVQACKAPDVSIASVALQHGLNTNLVSKWIRLIDGKPGNDRSPLPNKPAFIALSCSAPLDPTPTDMLTVQITLP
HSKAEIGLKWQVSEISALAELLKALAT

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
390 bp129 aa413802+No
ORF function : Accessory Gene
AG : IS66 TnpB

ORF sequence :

MASIRNICFSRITQGTCNMIRIDEIWLSTQPLDMRAGMDTIMAQVVRAFGYIKPHCAYLFCNKRGHRMKVLVHDGLGIWLCTRRLEQGKFHWAKVHQGEN
VALSPEQLQALIQGLPWQRIGRQQVVTML

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1605 bp534 aa8772481+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKMLPDLSQLTHEQLLEFTRQLAMQHQSLAQSNQELEKSNQQLDAKVQHLSILNQKYEHELALFKNHKFGSKNEHLTAKQIHLWDEAVEEDIAAVDLELE
RLNADKTDAVTQNATVNKPKRRLLPDHLHTIRIEHEPASTQCSCGCQLRRIGEDISEKLHFRPAQFYKEQHVRGKWVCDQCDTLTQQAMPAYVIDKGIAS
PELLSHVLVSKYADHLPLYRQRLIYQRAGIDLSRSTLSDWIGRCGVELEPLANALKQVVLQQRVIHADETPVTIMRMGDDEKKPKKGYVWAYATTQYNPV
QAVIYDFQDSRSGQHAEAFLNGWQGYLVCDDYSGYKARFKSGQVIEVGCMAHARRKFHELHVTGKSQVAEQALVLIQKLYAIEAELRKKTDGTAEDRREY
RQQHSQPVMQQLYEWLNQHHLTVPSSSPTAKAINYTLKRWSALSRYLDDGNLPICNNWVENQMRPWALGRKNWLFAGSLRSGQRAANIMTLIQSAKLNGL
DPYAYLSDVLKRLPTHKVTQIEELLPHCWKPKSN

 

Blast result :
Comments
ISAlw34 is 95% aa (transposase) similar to ISAlw16 and ISAba46.
References
1] Janos Kiss (2019) Direct submission.