ISAlw20

  • Family IS982
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
Acinetobacter lwoffii ZS207
Acinetobacter sp. ACNIH1
Acinetobacter sp. TTH0-4
DNA section
IS Length : 979 bp

Ends


IR Length : 12

IRL : ACCTGAGTTCGACATAAAAAATAAATAAAAAAAAGCCTTAGCATCTGTAA
IRR : ACCTGAGTTCGATGAAATATTTTAGCTTTTTAGCAAGTTTTGGAAAGTTG

Insertion site


Left flankDirect repeatRight flankDR Length
ctaatttgaagtcagcgttcaaattatttttattaaaggtttatgg6
gttttgatccagccggaaaataatttttctcgatcaaatcaaaaat6
cttattttttagtatcgtactacttaatatttccccactaatacct6
aattaaaaaacaggataaaataatgattttatttaactttaagtat6
aggtgtgtagtacattattctatatagtagaaaaaagaaaattcat6
ttcggcgtggttttttttattatttttatatattccggacaatatata8
ttaagctattaaggtaaaagtaattatatagatagtaaattccttaacaaaa0
TAGCTTCAAAGAATTATTGCTATTTATATAGAAAATCGAGATGAGT6
GTTTCATTAATTTTTCAATCTAAATAATATAGTTATTGGATCTAGC6
CTATATAAAAACAGTAATAATAAGAAGTATGTAATTTGACCATTAA6
AGACCCAACAGGCAAGAAAATAAATAAAAGGCCAATCGGGTTATGT6
AGGTTATGATTTGATAGAAATAATTATTAAAAAGAGTGGTCATGAA6
TGCAAAAGCGAACAAAGATATACTTAATACAGTGAGTCCAATGAGC6
TCAAAAAGAATGAAATAGTCTAAACTAGCCTTTTTGCACCAAATAAT7
ACTTGGCTGAATGGGCTTTTTATGGATAAATTATTTTTGCAAAAAGGC8
ATTGATCTTGTTTTTATATTTATTAAAATATCTTAGACCTCGTGAT6
TCAGAGTCTGGATGATGTTTTAAATACTATTGAACAAACCAATTCG0

DNA sequence

ACCTGAGTTCGACATAAAAAATAAATAAAAAAAAGCCTTAGCATCTGTAATATCTTGGTTACGAAGACAAAACATTTCAGAGCAAGGCTTTTTCATGGAC
TATATTACCGAATTATTTTGTATCTTGGATGATTTCTGCAAAAAGTTTAATGAATCTTTAGAGAAAGCTCTAATTTCTGATCAAAAAACAACAATGAAAA
AGTCAGCTTTAAGCTTGTCTGAAGTCATGACCATTGTCATTTTATTTCATAAATCCGGGTTTAGATTTTTCAAATATTTTTATTGTCATATGATCATCCC
ATTTTGGAAATCAGCTTTTCCCAAGCTTCTTAGTTACAATCGTTTTATTGAAATTATGCCGCGTTGTTTGCAAGCTTTGAGTAGTTTCTTCCATCAAGTT
AAAGGAGAAGATACCGGAATTTGTATTATTGATTCGACTAAATTGGTCGTTTGCCATAATCTTAGAATTAAAAGACATCGTGTATTTAAAGGCTTAGCTG
GTCGTGGTAAAAGTAGCACAGGTTGGTTTTATGGATTTAAAGTCCATATTGTTATCAACAACTTGGGTGAAATTATTAATCTCAAGATTACATCGGGAAG
TGTTCATGATGTTGCTGTACTTGAATCTTTAACCCAAGAGTTAAAAGGTATTTTACTGGGCGATAAAGGCTATCTGAGTAAAGCAAAAACTGAAGCTTTA
GCAGCAAGGGGGCTCAGACTATTAACCCCGTCACGCAAGAATATGAAAAATAAACCCATCCAAACTGAAGAAGAAAAACAATTGCTTTGCAGAAGAGGAT
TGATCGAAACAGTGAATGATCAGTTAAAAAACTTACATCAAATTGACCATTCACGTCATCGTTCGGTGAATAACTTTATGGTGAATATTATGGCTGCTAT
AGTGGCTTATTGCTTAAATCCAAATAAGCCAACTTTCCAAAACTTGCTAAAAAGCTAAAATATTTCATCGAACTCAGGT
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
864 bp287 aa95958+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MDYITELFCILDDFCKKFNESLEKALISDQKTTMKKSALSLSEVMTIVILFHKSGFRFFKYFYCHMIIPFWKSAFPKLLSYNRFIEIMPRCLQALSSFFH
QVKGEDTGICIIDSTKLVVCHNLRIKRHRVFKGLAGRGKSSTGWFYGFKVHIVINNLGEIINLKITSGSVHDVAVLESLTQELKGILLGDKGYLSKAKTE
ALAARGLRLLTPSRKNMKNKPIQTEEEKQLLCRRGLIETVNDQLKNLHQIDHSRHRSVNNFMVNIMAAIVAYCLNPNKPTFQNLLKS

 

Blast result :
Comments
ISAlw20 is 70% aa similar to ISNeu1.
References
1] Janos Kiss (2019) Direct submission.