ISAlw21

  • Family IS1595
  • Group IS1016
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
Acinetobacter indicus SGAir0564
DNA section
IS Length : 738 bp

Ends


IR Length : 17

IRL : GGGGCTTAGGAAGTTAAGCATATTAAAAAGTATGGTAACTTCCTTATATG
IRR : GGGGCTTAGGAAGTTAAAGAGGGTTGTTACGGAGTATTTTAAGCAAATCG

Insertion site


Left flankDirect repeatRight flankDR Length
CATTAAACAGTATTTACTGGAAATGCACTTTAA7

DNA sequence

GGGGCTTAGGAAGTTAAGCATATTAAAAAGTATGGTAACTTCCTTATATGAAAGCAAAAAATAGATACTATTCCCGTTCAAGGATCGCAGAAGCAAAATT
CAGGCAAATCATTCGCTTTTTTGCCATGGATTTTACTGCATCTGATACTGCTAAACTTACCAATATTTCTGTTCGCTCCATCAATACAATTTATATCAAA
TTGCGTAAAAAGATTGCTGTCCAATGTGAAGAAATATCTCCCTTCAATGGCATTATTGAACTGGATGAATCTTACTTTGGTGCTCGTCGTGTTCGTGGTA
AGCGAGGTCGTGGGGCATCAGGAAAAACCATTGTATTTGGGTTGCTCAAACGGGATGGAAATGTGTACACGGAAATTGTACCAGATTGCTCAAAAGCTAC
GCTGCAAGGGATTATCCGTGGGCATATAGAACTTGATTCAGTCATCAATACAGATGGATGGAGGGGGTATGATGGTTTAGTTGATATTGGCTTTGATAAG
CACTTAAGAGTAAATCACGGTGACAATGAATTTGCTTGTGGGGAACGTCATATTAACGGTATAGAATCCTTTTGGGGCTATGCGAAAAAGCGGCTCAGTA
AATTTAATGGAATTGACAAGAAGATGTTTTATTTGCATCTTAAAGAAACGGAATATCGCTTCAATCATCGCCATGGTAATTTATACCTCGATTTGCTTAA
AATACTCCGTAACAACCCTCTTTAACTTCCTAAGCCCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
678 bp225 aa48725+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKAKNRYYSHSRIAEAKFRQIIRFFAMDFTASDTAKLTNISVRSINTIYIKLRKKIAVQCEEISPFNGIVELDESYFGARRVRGKRGRGASGKTIVFGLL
KRDGNVYTEIVPDCSKATLQGIIRGHIELDSVINTDGWRGYDGLVDIGFDKHLRVNHGDNEFACGERHINGIESFWGYAKKRLSKFNGIDKKMFYLHLKE
TEYRFNHRHGNLYFDLLKILRDNPL

 

Blast result :
Comments
ISAlw21 is 97% similar to ISAju1.
Five copies are flanked by 7-bp DR, while one copy has 8-bp DR.
References
1] Janos Kiss (2019) Direct submission.