ISAlw22

  • Family ISNCY
  • Group IS1202
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
Acinetobacter lwoffii ED9-5a plasmid pALWED3.6
A. lwoffii ED45-23 plasmid pALWED2.1
DNA section
IS Length : 1482 bp

Ends


IR Length : 26

IRL : TGTTAGAACCCATTTAAAGTGTCTATATTCTCACCAATAAAAATGTCTGG
IRR : TGTTATTCACCAATTAAAATGTCTATGCGATAAACCATTTAAAATGTCCT

Insertion site


Left flankDirect repeatRight flankDR Length
taatggcgattatacgaaaggcccttgtaagtccaaaatagaaat5
TAATACACCTTATACGAAATGCGTTTGTACCAGATGAGCTATTAGATCTA0
TAATAGAGCTTATACGAAACGTATACCCAAGGCATGGCTTTTAGTCATGC0
TAATGGAGGTTATGCGAAGTCGACTTGTAATGCAATTTGCATTAC5
TAATGGCGGTTATACGAAGTCGACTTGTAATGCAATTTGCATTAC5

DNA sequence

TGTTAGAACCCATTTAAAGTGTCTATATTCTCACCAATAAAAATGTCTGGTTTATGATGGTTTTTATCACCATGGACTGGATATAAAATATAGATGCTGA
TCACTATGTCTGACAAAGAAATTCAACGTCTTGCAGTTCTGCAAGACGTTCGAGATCATCGTATTACCCAAGTCCGTGCTGCTGAAATCCTGAATCTTTC
CACCCGTCAAATTACCCGGTTATTGCAGAAGCTCAATCAAGATGGTGTTTCAGGCATGACGCATGCTAGTCGTGGTCAACCGGGTCATCGTCGCCATGAC
GTTCTGTTAAAATCAGAATGTCTTTCCATTATTTCTGAACATCTGCTGGGCTTTGGACCTACCTTGGCGCATGAGAAGCTCAGCAGCATGTTTGACCTGA
ATATCCCGGTAGAAACGGTTCGGCGCTGGATGACTGCAAATGACCTTTGGATTCCGCGATCCAAACGTCTAAAACGCCCATACCAGCCACGCTATAACCG
TGATTGCTTCGGTGAGCTGATCCAGATTGATGGCTCATATCATGACTGGTTTGAAGGAAGAGCCACCAAATGCTGTTTGCTGGTTTATATCGATGATGCT
ACCGGCAAGCTGTTGCATCTACGCTTTTGTGAGGCTGAAACGACCTTTGACTATATGCTTTCAACCCGAGCCTACATTGAGCAATACGGCAAGCCCTTGG
CCTTTTATAGCGATAAACACTCGGTATTTAGAGTCAACCAGAAATCCAGGCAAGACAGCCAGATCACGCAATTTGGGCGGATTCTGAATGAGTTAAACAT
TGATATTATCTTCGCCAATTCACCCCAGGCCAAAGGTCGCGTAGAGCGAGCGAATAGAACCCTTCAGGACCGTTTGATCAAGGAGATGCGCCTGGAAGGC
ATCTGTTCGATTGCAGAAGCAAATGCCTGGTTGCCCTGCTTTATTGAGCAGTTCAATCAGAAGTTCGCCAAATGTGCGCGAAACTCAAAGAACCTGCATC
GACCATTAACCGAATCTGATCTTGAACTGGATGATATTTTTACCTGGCAGGAACCGCGTAAGGTCACCAAGAACCTGACGATTACCTATGACAAATGTAT
TTATCTGCTTGAACCGACAGAGCTGAATCATAAGCTTGTTGGGCAATATATTTCATTTCTGGAGTACCCGGATGGGACTGTGGCCCTCATGCACGAGGGA
CGAAAGCTCAACTACAGCATTTTCAATAAATTAGCTGGGCTACAGCAGAATGAGATCGTTGAGAATAAACGGTTAGGTTCAGTCCTGGCACATATTCAGC
AACAGCATGAAGAGTTGGAAAAACAGAATAAACGTTCCCGTCTCAAGAAAAGTATGCCGAGTCGTAAAGCTCAGAAAGCTGTTATTGAACAAAGAAAGTT
AAATCCTGTGCTTGACTCTTGTGGTTAAAAACAGGACATTTTAAATGGTTTATCGCATAGACATTTTAATTGGTGAATAACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1335 bp444 aa941428+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLITMSDKEIQRLAVLQDVRDHRITQVRAAEILNLSTRQITRLLQKLNQDGVSGMTHASRGQPGHRRHDVLLKSECLSIISEHLLGFGPTLAHEKLSSMF
DLNIPVETVRRWMTANDLWIPRSKRLKRPYQPRYNRDCFGELIQIDGSYHDWFEGRATKCCLLVYIDDATGKLLHLRFCEAETTFDYMLSTRAYIEQYGK
PLAFYSDKHSVFRVNQKSRQDSQITQFGRILNELNIDIIFANSPQAKGRVERANRTLQDRLIKEMRLEGICSIAEANAWLPCFIEQFNQKFAKCARNSKN
LHRPLTESDLELDDIFTWQEPRKVTKNLTITYDKCIYLLEPTELNHKLVGQYISFLEYPDGTVALMHEGRKLNYSIFNKLAGLQQNEIVENKRLGSVLAH
IQQQHEELEKQNKRSRLKKSMPSRKAQKAVIEQRKLNPVLDSCG

 

Blast result :
Comments
ISAlw22 is 98% aa similar to ISAba32.
Three and one copies of ISAlw22 occur in A. lwoffii plasmids pALWED3.6 and pALWED2.1, respectively. Two copies have no direct repeat in pALWED3.6. The third one is flanked by 5-bp DR and located at the same position as the single copy of pALWED2.1.
References
1] Janos Kiss (2019) Direct submission.