ISAlw24

  • Family IS481
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
DNA section
IS Length : 1197 bp

Ends


IR Length : 21/26

IRL : TGTATTAGTTCAGACTTGATCGGACATTCTTCTTGAAAAAGAGAAAGTTA
IRR : TGTACTAGCTCAAACCTGATCTGACAGTTACCCATTTTTTATTGTGCCTG

Insertion site


Left flankDirect repeatRight flankDR Length
TACAGGCGTATGGCTTAAGCGGAATAGAGATAAAAAGAAA0

DNA sequence

TGTATTAGTTCAGACTTGATCGGACATTCTTCTTGAAAAAGAGAAAGTTACCCGTTTTGATAAAGGTGTCGAAATCTTAATCAAACAAAGGTAACTTTCT
TATGTTGCATACTAACAATCAAATTATCAAACACAAAGTAGGCTTACTCAATTTAGCCGAAGAACTTCAGAACGTTTCTAGAGCATGCAAAGTGATGGGT
GTCTCTAGAGATACTTTCTATCGCTATCAGGAGTTAGTACAGTCTGGTGACATTGATGCATTGATCAATAAGTCCCGTCGAGTGCCTAATCTAAAAAACC
GTGTAGATGATGCTACAGAGCTAGCGGTCATTGATTTCGCAATTCAATATCCAGCTTATGGTCAGCATCGTACCAGTAACGAATTGCGCAAGAAGGGTGT
ATTTGTTTCAGGGAGTGGTGTTCGCTCTATTTGGCTCCGCCATGATTTGGAGAACTTTAAGAAGCGTTTAAAAGCTCTCGAAGCTAAAGTGGCGCAGGAT
GGTATCGAACTAAATGATCATCAGATTGCTGCACTTGAGCGTAAGCATGAAGATGATGTGGCATGTGGTGAAATAGAAACAGCTCATCCAGGCTATTTAG
GTGCGCAAGATACCTTTTATGTCGGGAATCTCAAGGGTGTTGGACGGATCTACCAGCAAACATTTATCGATACTTATAGCAAGGTCGTTCATTGCAAGCT
CTATACAACCAAAACACCAATTACAGCGGCTGATTTACTCAATGATCGTGTATTACCTTTCTATCAATCCCAGGATTTACCAATGCTTCGCATTCTTACA
GACAGAGGAACCGAGTATTGCGGGAAGGTGGAACAACATGACTATGAGTTGTATCTAGCCCTCAATGACATTGATCACACGAAGACAAAAGCAGCTTCAC
CACAAACGAATGGGATCTGTGAACGCTTCCATAAAACAATACTGCAGGAGTTTTATCAAATTACATTTAGGAAAAAGCTTTATAGCACACTAGAAGAGTT
GCAGACGGATCTAGACGACTGGCTGAAATTCTATAATACTGAACGGACTCATCAAGGAAAAATGTGCTGTGGTCGTACACCATTTGAAACTTTACTTGAT
GGAAAACAAATTTGGGCTGAGAAGAATTTAGCTCAAATTTAACCTGACAGGCACAATAAAAAATGGGTAACTGTCAGATCAGGTTTGAGCTAGTACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1041 bp346 aa1021142+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLHTNNQIIKHKVGLLNLAEELQNVSRACKVMGVSRDTFYRYQELVQSGDIDALINKSRRVPNLKNRVDDATELAVIDFAIQYPAYGQHRTSNELRKKGV
FVSGSGVRSIWLRHDLENFKKRLKALEAKVAQDGIELNDHQIAALERKHEDDVACGEIETAHPGYLGAQDTFYVGNLKGVGRIYQQTFIDTYSKVVHCKL
YTTKTPITAADLLNDRVLPFYQSQDLPMLRILTDRGTEYCGKVEQHDYELYLALNDIDHTKTKAASPQTNGICERFHKTILQEFYQITFRKKLYSTLEEL
QTDLDDWLKFYNTERTHQGKMCCGRTPFETLLDGKQIWAEKNLAQI

 

Blast result :Comments : ISAlw24 is 84% aa similar to ISSod13. This sequence is disrupted by an isoISAba125 insertion, which have generated a 3-bp duplication . The sequence was reconstituted in silico by the deletion of the IS element and one copy of the duplication.
Comments
ISAlw24 is 92% aa similar to ISSod13.
ISAlw24 is integrated in an isoISAba44 copy in strain M2a. The closest relative (92% similar) of ISAlw24 occurs in three copies in Acinetobacter johnsonii strain IC001 chromosome (CP022298.1).
References
1] Janos Kiss (2019) Direct submission.