ISAlw35

  • Family IS481
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019143 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii ZS207
DNA section
IS Length : 1197 bp

Ends


IR Length : 20/26

IRL : TGTATTAGTTCAGACTTGATCGTACATTCTTCTTGAAAAAGAGAAAGTTA
IRR : TGTACTAGCTCAAACCTGATCTGACAGTTACCCATTTTTTATTGTGCCTG

Insertion site


Left flankDirect repeatRight flankDR Length
tttgggttggtaggagatattaaatctaatctccatccaaatcaattgagacact0

DNA sequence

TGTATTAGTTCAGACTTGATCGTACATTCTTCTTGAAAAAGAGAAAGTTACCCGTTTTGATAAAGGTGTCGAAATCTTAATCAAACAAAGGTAACTTTCT
TATGTTGCATACTAACAATCAAATCATTAAACACAAAGTAGGTCTGCTCAATTTAGCTGAAGAGCTTCAGAATGTATCCAGAGCATGCAAAGTGATGGGT
GTTTCAAGAGATACATTTTATCGCTATCAAGAGTTAGTGAAGTCTGGTGATATTGACGCACTGATCAATAAATCCCGTCGAGTACCAAATTTAAAAAACC
GTGTAGATGATGCTACTGAACAGGCCGTTATTGATTTCGCAATTCAATATCCCGCATATGGTCAGCACCGTACTAGTAATGAATTACGCAAGAAAGGTGT
ATTCGTTTCAGGGAGTGGGGTTCGCTCTATATGGCTTTGTCATGATTTAGAAAACTTTAAGAAGCGTTTAAAAGCACTTGAGGCTAAAGTGGCACAGGAT
GGTACTGAATTAAATGATCAGCAGATTGCGGCACTTGAACGTAAGCATGAGGATGACGTTGCTTGTGTTGAAATCGAAACAGCTCATCCAGGCTATTTAG
GCGCGCAAGACACCTTTTATGTCGGGAATCTCAAAGGTGTTGGACGAATCTACCAACAAACATTCATCGACATTTATAGCAAGGTCGTTCATTGCAAGCT
CTATACAACAAAAACACCGATTACAGCGGCTGATTTACTCAATGATCGTGTGTTGCCATTCTATCAATCTCAGGACTTACCAATGCTTCGCATCCTCACA
GACAGAGGTACTGAGTATTGCGGTAAGGTAGAACAACATGACTATGAGTTGTATCTGGCAGTTAATGATATTGATCACACGAAGACAAAAGCAGCTTCCC
CGCAAACAAATGGTATATGTGAGCGTTTCCATAAGACGATTTTGCAGGAGTTCTATCAAATTACGTTTAGGAAGAAGCTTTATAGCTCATTGGAAGAATT
ACAGGTTGATCTAGACGATTGGCTGAAATTCTATAATACTGAACGGACTCATCAAGGAAAAATGTGCTGTGGTCGTACACCACTTGAAACTTTACTTGAT
GGAAAACGGATTTGGGCTGAGAAGAATTTAGCTCAAATTTAACCTGACAGGCACAATAAAAAATGGGTAACTGTCAGATCAGGTTTGAGCTAGTACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1041 bp346 aa1021142+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MLHTNNQIIKHKVGLLNLAEELQNVSRACKVMGVSRDTFYRYQELVKSGDIDALINKSRRVPNLKNRVDDATEQAVIDFAIQYPAYGQHRTSNELRKKGV
FVSGSGVRSIWLCHDLENFKKRLKALEAKVAQDGTELNDQQIAALERKHEDDVACVEIETAHPGYLGAQDTFYVGNLKGVGRIYQQTFIDIYSKVVHCKL
YTTKTPITAADLLNDRVLPFYQSQDLPMLRILTDRGTEYCGKVEQHDYELYLAVNDIDHTKTKAASPQTNGICERFHKTILQEFYQITFRKKLYSSLEEL
QVDLDDWLKFYNTERTHQGKMCCGRTPLETLLDGKRIWAEKNLAQI

 

Blast result :
Comments
ISAlw35 is 92% aa similar to ISSod13.
The closest relatives of ISAlw35 (99% similar) occur in Acinetobacter johnsonii LXL_C1 (CP031011.1), Acinetobacter sp. LoGeW2-3 (CP024011.1) chromosome and Acinetobacter pittii 2014N21-145 plasmid p2014N21-145-1 (CP033569.1).
References
1] Janos Kiss (2019) Direct submission.