ISAlw33

  • Family IS30
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019143.1 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii ZS207
DNA section
IS Length : 1071 bp

Ends


IR Length : 20/26

IRL : CGCGGATTCAAATCCCAAGTGCGACACATTTGTAGTTAGTTGAAAAAGTT
IRR : GGCGGATTCAAGCGGCAAGTGCAACAGTATAAAAACCAGCCATAACATCA

Insertion site


Left flankDirect repeatRight flankDR Length
ggtattaccttcagctttgagatcataaagtgatttggctaaa3

DNA sequence

CGCGGATTCAAATCCCAAGTGCGACACATTTGTAGTTAGTTGAAAAAGTTAGGTGTATTAGAATCATTAGACTTTTTCAACTCGCAATTGGAAAGCACAC
AATGAAGCAATACACCCAACTTTCTCAAGAAGAAAGATACGAAATTTATGCTGCCTTGAAAAGTAAATCTTCAATCTCTACTCTTTCCAGAGAGCTTGGT
CGTTCCAGATCAACCCTCTATCGTGAGATCAAAAGGAATACAGGGGAACGCGGCTATCGGGCTAAACAGGCTGATCGGTTTTCAAGTCAACGACGATACC
GTTCTTCATCTCAGATGACAGACTTCGCCATATTTTACATCCGTTATCTGATTGCTCTGGATTGGTCGCCTGAACAGATTTCCGGGGCATTGAAACAACG
TGGCTGGCTAGATGTCCCATCACATGAGTGGATCTATCAGTACATCTATCAGGATAAATCTAAGGGTGGAGAACTGCATCAACATTTAAGACACCAGAAA
ACCTATCGCAAGCGGGGTTATAAAAACACAGACCGTAGAGGCCAACTGGTTGATAGAACAAGCATTCACTGTCGCGACGAGGTCATAGACAAGCGTCAAC
GTCTTGGTGATTTTGAAGGTGATACCGTGATAGGCAAGAATCATAAGGGGGCATTATTAACCCTGGTTGATCGCAAGAGTCTGTATCTACATATCGCTCA
TTTGGGGAAAACTAGAACCTCAGCTAAAACGATCACGTGTGCTTTAGAGTGTTTGCGCCACAGTCATGCATATAGTGTGACCTTTGATAATGGCAAGGAA
TTCTCAGAGCATTGGCGGATAAAGGAAGCAGGTATAGAAACTTACTTTGCAGATCCGTACAAGTCGATTCAACGTGCCAGAAATGAAAATAGCAATGGTC
TGATCAGGCAATATCTGCCAAAATCCTCATCGTTTGATGATGTTTCAAAAGAACGGATAGAACAGATAGAATCTGCTCTAAATAATCGCCCCAGAAAGAC
ACTGGGATGGTATACGCCCAGTGATGTTATGGCTGGTTTTTATACTGTTGCACTTGCCGCTTGAATCCGCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
963 bp320 aa1021064+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKQYTQLSQEERYEIYAALKSKSSISTLSRELGRSRSTLYREIKRNTGERGYRAKQADRFSSQRRYRSSSQMTDFAIFYIRYLIALDWSPEQISGALKQR
GWLDVPSHEWIYQYIYQDKSKGGELHQHLRHQKTYRKRGYKNTDRRGQLVDRTSIHCRDEVIDKRQRLGDFEGDTVIGKNHKGALLTLVDRKSLYLHIAH
LGKTRTSAKTITCALECLRHSHAYSVTFDNGKEFSEHWRIKEAGIETYFADPYKSIQRARNENSNGLIRQYLPKSSSFDDVSKERIEQIESALNNRPRKT
LGWYTPSDVMAGFYTVALAA

 

Blast result :
Comments
ISAlw33 is 80% similar to IS18.
References
1] Janos Kiss (2019) Direct submission.