ISAlw23

  • Family IS3
  • Group IS51
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
DNA section
IS Length : 1308 bp

Ends


IR Length : 25

IRL : TGAACCGTACCGGGTTTGTCGGAGAGTCAATATTCTGAGAGACTATCCCG
IRR : TGAACCGTACCGGGTTTGTCGGAGACTTTTTATTTAAGTTAGGCCACCTG

Insertion site


Left flankDirect repeatRight flankDR Length
0

DNA sequence

TGAACCGTACCGGGTTTGTCGGAGAGTCAATATTCTGAGAGACTATCCCGATGACAAAATTAAAATATACCCCTGAAATCAGAGAAAGAGCGGTTCAATT
ATTGATTGAATCTGAAAAAGATTATCCATCGAATTGGGCTGCGATCACCGCTATTGCTCCCAAGATAGGTTGTACTCCTGAAACACTCCGTGTTTGGTAT
CAAAAATACTTAGATCAACAAAATCCTATTAAAGTACAACAGATATCTGATCAAGAAAAAATGAAGCAAATGGAACGTGAAATTAAAGAATTAAAGCGTG
CCAATGAAATTCTACGTAAAGCAGCCGCTTTTTTCGCCCAGGCGGAGCTCGACCGCCCACACAAATAATGGTGGATTTTATCCATAACAATAAAGACTTA
TATGGTGTTGATGCGATTTGTAGGATTTTACCGATCGCAGCTTCAACCTATTACCGGACTCTAGATCTCTGCGAAAATCCAGAACATCGAGCAAAGCGAG
ATTTACATGATTTACATCATGCAGAGCAAATCAAACGTATTTGGAAAGAAAGTTCAGGTCGATATGGTGTACGTAAAGTTTGGCAACAATTGAAACGTGA
GGGTCATGTTATTGCACGTTGTACAGTTGCTCGATTGATGCAAAAGCTAGATATACAAGGTGTTTGGCGTGGTAAGAACAAACAAACTACCCGCAGCCGA
GATGATCAAAAACGGGCAGGTGATTTAGTGAAACGGAATTTTAGTGCTGATCGACCTGACCAATTATGGGTCAGTGACTTTACGTATATTCAAACCAATT
CTGGCTGGGTCTACACCGCATTTATTATTGATGTGTTCTCACGAGCAATTGTTGGATGGAAAGTATCTACACGGATGAATACAGATATGGTGCTCGATGC
ATTGGAGCAAGCATTGCACGATCGAGGCATGCCAAAGAATGTAATTCATCATTCAGATAGAGGTGTTCAATATCTTTCTATTCGCTATACCAATCGTTTA
GAAGCAGCAAATTTACGAGCATCAGTCGGTACAACGGGTGATTCATACGATAATGCTTTGGCTGAAACGGTGAATGGCTTATACAAAACAGAGGTGATTG
AATATTTAAAAGCAGATTGGCAAGGTTTAGCAGATGTACAACTTGCGACATTAAATTGGGTAGATTGGTTCAACAAAAAGCGTGTACACGGTGCACTGGG
TTATGTATCGCCTTTTGAGTTTGAAGCAATGTACTATGATAAGATTAATCCGTTAGGTCAGGTGGCCTAACTTAAATAAAAAGTCTCCGACAAACCCGGT
ACGGTTCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
318 bp105 aa51368+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MTKLKYTPEIRERAVQLLIESEKDYPSNWAAITAIAPKIGCTPETLRVWYQKYLDQQNPIKVQQISDQEKMKQMEREIKELKRANEILRKAAAFFAQAEL
DRPHK

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
951 bp316 aa3201270+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

SSRFFRPGGARPPTQIMVDFIHNNKDLYGVDAICRILPIAASTYYRTLDLCENPEHRAKRDLHDLHHAEQIKRIWKESSGRYGVRKVWQQLKREGHVIAR
CTVARLMQKLDIQGVWRGKNKQTTRSRDDQKRAGDLVKRNFSADRPDQLWVSDFTYIQTNSGWVYTAFIIDVFSRAIVGWKVSTRMNTDMVLDALEQALH
DRGMPKNVIHHSDRGVQYLSIRYTNRLEAANLRASVGTTGDSYDNALAETVNGLYKTEVIEYLKADWQGLADVQLATLNWVDWFNKKRVHGALGYVSPFE
FEAMYYDKINPLGQVA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1220 bp406 aa511270+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MTKLKYTPEIRERAVQLLIESEKDYPSNWAAITAIAPKIGCTPETLRVWYQKYLDQQNPIKVQQISDQEKMKQMEREIKELKRANEILRKAAAFFRPGGA
RPPTQIMVDFIHNNKDLYGVDAICRILPIAASTYYRTLDLCENPEHRAKRDLHDLHHAEQIKRIWKESSGRYGVRKVWQQLKREGHVIARCTVARLMQKL
DIQGVWRGKNKQTTRSRDDQKRAGDLVKRNFSADRPDQLWVSDFTYIQTNSGWVYTAFIIDVFSRAIVGWKVSTRMNTDMVLDALEQALHDRGMPKNVIH
HSDRGVQYLSIRYTNRLEAANLRASVGTTGDSYDNALAETVNGLYKTEVIEYLKADWQGLADVQLATLNWVDWFNKKRVHGALGYVSPFEFEAMYYDKIN
PLGQVA

 

Blast result :Comments : The third ORF is a putative ORFAB transposase reconstructed in silico by a possible -1 frameshift.
Comments
ISAlw23 is 98% aa (transposase) similar to ISAba2.
The third ORF is a putative ORFAB transposase reconstructed in silico by a possible -1 frameshift.
References
1] Janos Kiss (2019) Direct submission.