ISAlw6

  • Family IS3
  • Group IS407
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii M2a
DNA section
IS Length : 1200 bp

Ends


IR Length : 33/46

IRL : GGTAATGCTCCCTAAAAATAATTGAACTTAAAAGTAGAAAATCGAATAGC
IRR : GGTAATACCCCCATTTTTAATTGAGTTAATGAGTAGAAAAACCGAAGCCT

Insertion site


Left flankDirect repeatRight flankDR Length
tataaaaaagatgatgagtcataaggatctggttttagat0

DNA sequence

GGTAATGCTCCCTAAAAATAATTGAACTTAAAAGTAGAAAATCGAATAGCCTTGATCTAAGGAGATTTTCTATGAAAACATCTAAATATTCGGACAGCTT
AATCATGAGTATTTTGAAGCAAGCTGAAGCAGGTACTCCAGTGCCTAATCTATGCCGAGAACATGGCATGAGTTCTGCCACTTTTTACAAATGGAAGTCC
AAATATGGCGGCATGGATCTTTCCATGATGACTCGACTTAAAGAGCTAGAGACAGAAAATGCCCGCCTAAAGCGCATGTATGCGGATGAACGTCTTAAAG
CAGACATTCTTCAGGATGCACTGTCAAAAAAGTTATAAGGCCAACGCAACGCAAGTCACTTGCTCAACAAGCCGTTGAGCAATATAAGATATCAGTGAAT
AAGGCCTGTCTCATATTCCAAGTCAGTCAAACCTGTTATCGCTATATAGCTCAATTGAAGGAGCAGAATATGGTTATTGCAGATTGGCTGATTAAGCTCA
CCAATGAGAATAAGACTTGGGGATTTAAGCTTTGCTTTTTGTACCTGCGTAATGTCCAAGGCTACCCTTGGAATCACAAGCGTATTTATCGCATTTATAA
GGAGCTTGAGCTTAACCTTCGGATTAAACCCAACAAACGCATTAAACGGATAAAGCCTGAAACTCTTGCAGTACCAGAAGCGCAGAATGAATCATGGTCA
ATGGACTTTATGCACGATCAACTCAGTGATGGCCGCAGTTACCGTGTGCACAACGTCATTGATGACTATAACCGTGAGTCATTAGATATCTTGATTGACT
TCTCCTTACCCGCCGAACGAGTACTTCGAGGGTTGGATCAACTCATCGAATGGCGAGGTAAACCAAAACGAATCCGAAGTGACAATGGACCAGAGTACAT
CAGTGATTTAATGGAGGCATGGTGTAAGCAGCATGAAATTGAGCATGTATTTACCCAGCCTGGCAATCCACAACAAAATGCGTATGTAGAACGCTTCAAT
CGGACAGTACGTTATGAATGTTTAAATCAATATTTATTTCGAGAACTTGAAGATGTTCAAGACTATACAACAGCATGGCAACACTTTTATAATCATCAAC
GACCTCATATGTCAGTTGATGGTAAACCACCTAAATTTAAACAATGATAAAGGCTTCGGTTTTTCTACTCATTAACTCAATTAAAAATGGGGGTATTACC
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
267 bp88 aa72338+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MKTSKYSDSLIMSILKQAEAGTPVPNLCREHGMSSATFYKWKSKYGGMDLSMMTRLKELETENARLKRMYADERLKADILQDALSKKL

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
852 bp282 aa2991150+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

SRHSSGCTVKKVIRPTQRKSLAQQAVEQYKISVNKACLIFQVSQTCYRYIAQLKEQNMVIADWLIKLTNENKTWGFKLCFLYLRNVQGYPWNHKRIYRIY
KELELNLRIKPNKRIKRIKPETLAVPEAQNESWSMDFMHDQLSDGRSYRVHNVIDDYNRESLDILIDFSLPAERVLRGLDQLIEWRGKPKRIRSDNGPEY
ISDLMEAWCKQHEIEHVFTQPGNPQQNAYVERFNRTVRYECLNQYLFRELEDVQDYTTAWQHFYNHQRPHMSVDGKPPKFKQ

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1079 bp358 aa721150+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKTSKYSDSLIMSILKQAEAGTPVPNLCREHGMSSATFYKWKSKYGGMDLSMMTRLKELETENARLKRMYADERLKADILQDALSKKVIRPTQRKSLAQQ
AVEQYKISVNKACLIFQVSQTCYRYIAQLKEQNMVIADWLIKLTNENKTWGFKLCFLYLRNVQGYPWNHKRIYRIYKELELNLRIKPNKRIKRIKPETLA
VPEAQNESWSMDFMHDQLSDGRSYRVHNVIDDYNRESLDILIDFSLPAERVLRGLDQLIEWRGKPKRIRSDNGPEYISDLMEAWCKQHEIEHVFTQPGNP
QQNAYVERFNRTVRYECLNQYLFRELEDVQDYTTAWQHFYNHQRPHMSVDGKPPKFKQ

 

Blast result :
Comments
ISAlw6 is 96% aa (transpôsase) similar to ISAbe6.
The third ORF is the putative ORFAB transposase reconstructed by possible -1 frameshift.
References
1] Janos Kiss (2019) Direct submission.