ISAlw28

  • Family IS3
  • Group IS407
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019144 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii ZS207 plasmid pmZS
DNA section
IS Length : 1184 bp

Ends


IR Length : 36/37

IRL : GTAATCCCTCCTAAAAACAATAGGACCTAAAAGTAGAATTTTCTCTTAAA
IRR : GTAATCCTCCCATAAATAACTGAAGTTAAAAGTAGAGGTTAAGCAGCCAT

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GTAATCCCTCCTAAAAACAATAGGACCTAAAAGTAGAATTTTCTCTTAAAGTATAGGCAGTAGATTCTGCATGAAAACATCTAAATTTACTGACAGTCAG
ATCATGTCCATTTTGAAACAGGGGGAGTCTGGCACACCTGTAGCCGCCCTTTGTCGTGAACACGGTATGAGTAATGCGACCTTCTATAAATGGCGTGCCA
AATATGGCGGTATGGATACATCATTAATGGCAAAACTCAAAGAACTGGAAGCAGAAAATACCAGACTTAAAAAGATGTATGCTGAGGAACGCTTAAAGGC
AGAGATCATTCAGGAAGCGATGGCAAAAAAGTGGTGAGGCCATCTTGCCGACGTAAGATGCCACAACAGGCAGTTGCCCACTATGCGATTAGCATTCGTT
TGGCTTGCCGAGCATTTAGTATCAGTGAAACCTGCTACCGTTATCAATCCAAGTTAAACGATGACAATACATTAATTGCAGAACAGCTCATTGAGCTCAC
TGAAGAAAATACAGATTGGGGTTTTGGTCTGTGTTTCTCTTATCTACGTCATGTTGAAAACCATGTTTGGAATCATAAACGTGTTTATCGCATTTACTGT
GAGTCAGCACTGAATCTGCGCATTAAACCGAGAAGAAGACTAAAACGGCATGCACCAGAACCACTGAAAGAGCCGATCCGGGCAAATCAGGTCTGGTCAC
TGGATTTTATGCATGACCAGCTGATCGATAGTCGTAAGTTCCGATTGTTGAATGTGATTGATGATTACCGTCGAGAAGGTTTGACTATTGAAGCAGAATT
CTCATTACCCACGATCAGGGTTATTCACACATTGAATCAGTTATTGGAATGGCGAGAAAAACCGTTAGTTATTCGGTGTGACAATGGCCCGGAGTTTATC
AGTCACGAATTTGTACGCTGGGCAACTGAACAAGGTATTCGTATTGAATATATTCAACCAGGTAAACCACAGCAGAATGCGTATATTGAACGCTATAATC
GGACTATACGTTATAGTTGGCTGAGCAAACATTTATTTGATACTTTGGATGAAGTACAAGATTATGCAACAAACTGGCTGTGGCATTACAACCATGAAAG
ACCACACCAAGCAAACAAAGGAAGGCCACCTCTAATGGCTGCTTAACCTCTACTTTTAACTTCAGTTATTTATGGGAGGATTAC
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
270 bp88 aa71340+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MKTSKFTDSQIMSILKQGESGTPVAALCREHGMSNATFYKWRAKYGGMDTSLMAKLKELEAENTRLKKMYAEERLKAEIIQEAMAKKW

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
864 bp286 aa2861149+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

GTLKGRDHSGSDGKKVVRPSCRRKMPQQAVAHYAISIRLACRAFSISETCYRYQSKLNDDNTLIAEQLIELTEENTDWGFGLCFSYLRHVENHVWNHKRV
YRIYCESALNLRIKPRRRLKRHAPEPLKEPIRANQVWSLDFMHDQLIDSRKFRLLNVIDDYRREGLTIEAEFSLPTIRVIHTLNQLLEWREKPLVIRCDN
GPEFISHEFVRWATEQGIRIEYIQPGKPQQNAYIERYNRTIRYSWLSKHLFDTLDEVQDYATNWLWHYNHERPHQANKGRPPLMAA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1079 bp358 aa711149+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKTSKFTDSQIMSILKQGESGTPVAALCREHGMSNATFYKWRAKYGGMDTSLMAKLKELEAENTRLKKMYAEERLKAEIIQEAMAKKVVRPSCRRKMPQQ
AVAHYAISIRLACRAFSISETCYRYQSKLNDDNTLIAEQLIELTEENTDWGFGLCFSYLRHVENHVWNHKRVYRIYCESALNLRIKPRRRLKRHAPEPLK
EPIRANQVWSLDFMHDQLIDSRKFRLLNVIDDYRREGLTIEAEFSLPTIRVIHTLNQLLEWREKPLVIRCDNGPEFISHEFVRWATEQGIRIEYIQPGKP
QQNAYIERYNRTIRYSWLSKHLFDTLDEVQDYATNWLWHYNHERPHQANKGRPPLMAA

 

Blast result :
Comments
ISAlw28 is 97% aa (transposase) similar to ISAca1.
The third ORF is the putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
ISAlw28 is 93% similar to ISAca1. The closest relatives (99 and 98% similar) occur in A. lwoffii NCTC5866 (LR215976.1) and A. johnsonii IC001 (CP022298.1). Neither of these copies are flanked by DRs.
References
1] Janos Kiss (2019) Direct submission.