ISAlw26

  • Family IS3
  • Group IS3
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019143.1 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii ZS207
DNA section
IS Length : 1238 bp

Ends


IR Length : 39

IRL : TGATCCTAGACAAAATAATGGACAGCACGTCCCTCTAAAGATAACGTAAC
IRR : TGATCCTAGACAAAATAATGGACAACCAGCCCCTCTAAACTTTTAATATA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

TGATCCTAGACAAAATAATGGACAGCACGTCCCTCTAAAGATAACGTAACTTTAATCTTTGGAGATTCAAGAAATGGCTAAACGTTTTAGTCCCGAATTT
AAACAGCAAGCGATTGATTATGCACTTTCAAATTCACACGAGCCTATAGCTGCAATCGCCCAGAAATTAGGTGTGGGTTATTCAACATTAGATAAATGGA
TTCGTGAAACCAATCCGGCAGGTTCAAGCAAACGTCAACTTTCACCAGAACAACAGCGGATCGTGGAATTAGAGAAAGAAGTCAAACAGCTCAAGGAAGC
CAATGACATCTTAAAAAAAGCGCATGTGTACTTTCTAACAGATCATGCCAAGAAAAGTACACGGTAATTCAAGATCTAGATATGAATGAAGTCACCGTAT
CTTCTGCCTGTAAATACCTAGGTGTCAGCACTTCAGGCTATTATGCCTGGCGAAAACGTCAAGCCAATACGGCACAGAAATATAATGACTTAAAAGCCGT
ATATTGGCAGCATCATGCACGATTGGGTGCACCTTCATTAGTACATGACATGCATGATTTAGGTTACAACATGAGCGAACGTACTATTGGAAGGATGCTA
AAAAAGCTTGGTTTACGTAGCAGGATTGCGCGTAAATACAAGCATACGACTGATTCAACCCATCGTTTGCCTACAGCACCCAACTTGTTGGATCGCCAAT
TTACAGTTACTCAGCCTAATAAAGTCTGGACAACAGACATTACCTATATCCGCACTAAAGAAGGTTGGTTGTATTTATGTGTAATGCTAGATTTATTTAG
CCGTCGTATCGTGGGGTGGCAAACCAGCCATCGAATAGACCGCCAGTTGGTGTGTGATACGTTTAACTATGCAATGGCTCGTCAGGGTTATCCAACTGGT
GTTATGGTTCATTCGGACCAAGGCTCACAGTACTGTAGTCGTGATTTTAGAGCGCTGTTACTGAAAAATGATTGTACTCAGAGTATGTCTAGACGTGGAA
ACTGTTGGGATAATGCAGTGACTGAAAGCTTCTTTCATACATTAAAAGGTCATGTGGTACATGGCAGTGTGTTTTCGACTCGAAAAGAAGCGAATGCTGT
CTTGTTTGACTATATTGAAATTTATTACAATCGAGTCAGAAGACATTCTGCAAACGGCTGGTTAAGTCCAGAAGCCTTTGAACAGAAATATATTAAAAGT
TTAGAGGGGCTGGTTGTCCATTATTTTGTCTAGGATCA
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
297 bp97 aa74370+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MAKRFSPEFKQQAIDYALSNSHEPIAAIAQKLGVGYSTLDKWIRETNPAGSSKRQLSPEQQRIVELEKEVKQLKEANDILKKAHVYFLTDHAKKSTR

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
930 bp308 aa3071236+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

HLKKSACVLSNRSCQEKYTVIQDLDMNEVTVSSACKYLGVSTSGYYAWRKRQANTAQKYNDLKAVYWQHHARLGAPSLVHDMHDLGYNMSERTIGRMLKK
LGLRSRIARKYKHTTDSTHRLPTAPNLLDRQFTVTQPNKVWTTDITYIRTKEGWLYLCVMLDLFSRRIVGWQTSHRIDRQLVCDTFNYAMARQGYPTGVM
VHSDQGSQYCSRDFRALLLKNDCTQSMSRRGNCWDNAVTESFFHTLKGHVVHGSVFSTRKEANAVLFDYIEIYYNRVRRHSANGWLSPEAFEQKYIKSLE
GLVVHYFV

 

Blast result :Comments : Second part of transposase.
ORF 3
LengthBeginEndStrandFusion ORF
1163 bp386 aa741236+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MAKRFSPEFKQQAIDYALSNSHEPIAAIAQKLGVGYSTLDKWIRETNPAGSSKRQLSPEQQRIVELEKEVKQLKEANDILKKSACVLSNRSCQEKYTVIQ
DLDMNEVTVSSACKYLGVSTSGYYAWRKRQANTAQKYNDLKAVYWQHHARLGAPSLVHDMHDLGYNMSERTIGRMLKKLGLRSRIARKYKHTTDSTHRLP
TAPNLLDRQFTVTQPNKVWTTDITYIRTKEGWLYLCVMLDLFSRRIVGWQTSHRIDRQLVCDTFNYAMARQGYPTGVMVHSDQGSQYCSRDFRALLLKND
CTQSMSRRGNCWDNAVTESFFHTLKGHVVHGSVFSTRKEANAVLFDYIEIYYNRVRRHSANGWLSPEAFEQKYIKSLEGLVVHYFV

 

Blast result :
Comments
ISAlw26 is 97% aa (transposase) similar to ISAcsp3.
The third ORF is the putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
ISAlw26 is 91% and 90% similar to ISAcsp3 and IS1236, respectively. Its closest relatives (99% similar) are present in Acinetobacter sp. WCHAc010005 (CP032134.1) and A. haemolyticus TJR01 (CP038009.1) chromosome in two and four copies, respectively.
copies and
References
1] Janos Kiss (2019) Direct submission.