ISAlw27

  • Family IS3
  • Group IS150
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
CP019143.1 ND Acinetobacter lwoffii
Acinetobacter lwoffii
Acinetobacter lwoffii ZS207
Acinetobacter lwoffii EK30A pALWEK1.1
DNA section
IS Length : 1282 bp

Ends


IR Length : 28

IRL : AGAGATGGCTCCGTAAATTTGAACAACTCCTATAAGTGATATTTTGCTCC
IRR : AGAGATGGTCCCACTTGTTTGAACAACTAAAAGCTTATTTATAAGTGATA

Insertion site


Left flankDirect repeatRight flankDR Length
catggttaagcctatgagtcattactaggatgtgacattctgca4

DNA sequence

AGAGATGGCTCCGTAAATTTGAACAACTCCTATAAGTGATATTTTGCTCCCCAAATGATGTTATAAACATCGATATATGGAGTATTTTATGGCACGTAGA
CCAAGAAGAAATCATTCAAATGACTTTAAAGCTAAGGTAGCGCTTGCTGCGATTAAAGCAGAAAAAACACTTGCTGAATTGAGTGCTGAATTTGATGTTC
ATCAAAACCAAATTATCGACTGGAAAAATCAATTGCTTTCAGCTTCCTCGCAAGCCTTCGATCAATCAAAAGCTCCAGCAGAACCGCCCATTGATCTAAA
AAAACTACATGCAAAAATCGGTGAACAGGCATTAGAAATTGATTTTTTAGAAGGTGTGTTGAAGAAACTGGGCCGCTTCAACCACAAAAGTTAATCGACG
ACTCACTTCAGATTTCAGTATCTAAGCAAGCTAAGCTACTGAAAGTCTCCCGTGGTTGTTATTACTATCGCCCAAAACCTGTGAGTGCATCAGATCTGAA
GCTGATGCGCTGTATTGATGAATTACATATGCAATACCCTTTTGCAGGTAGCCGTATGATGCGTGATTTATTGAACCGTCAAGGACATCATATAGGACGA
CGTCATACACGTACTTTAATGAAGAAAATGGGCATTAATGCGTTATATCGTAAACCAAATCTAAGTCAGGCCAATCAAGCTCACCGTAAATATCCATATC
TGCTCAAAGGATTGAATATTCAACGGAGTAATCAAGTGTGGGCAACGGATATAACGTATATCCCTATGGCAAAAGGCTTTGTCTACTTATGTGCTGTGAT
TGATTGGCACAGCCGTAAGGTGCTTGCCCATAGCGTATCGATTAGTATGGAGGTTGCATTTTGTATAGAAACATTAAATGAAGCTATTGAAAAATATGGC
CGACCTGAAATCTTTAATACAGACCAAGGCAGTCAATTTACCAGTGATGCATTTATTGAAGTGTTAAAATCAAATGACATCCAAATCAGCATGGATGGTA
AAGGTCGTTGGGTTGATAATGTGATGATTGAACGATTATGGCGGAGCGTTAAATACGAGGAGGTTTATCTCAAAGCCTACAGCAATGTTTTTGATGCGAA
AAAGCAATTAAATGCCTATTTTGAATTTTATAATTTGAAACGACCTCATTCGAGTCTGGACAAAATGACTCCAGATGAGTTTTACTATGACCAGCTACCA
CAACAAAATAAGGTAGCTTAACTAGAGCAGAATATCACTTATAAATAAGCTTTTAGTTGTTCAAACAAGTGGGACCATCTCT
Recoding section
  • Recoding by frameshift
  • Frame -1
  • Type translational
  • Experimentally demonstrated No

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
318 bp105 aa77394+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MEYFMARRPRRNHSNDFKAKVALAAIKAEKTLAELSAEFDVHQNQIIDWKNQLLSASSQAFDQSKAPAEPPIDLKKLHAKIGEQALEIDFLEGVLKKLGR
FNHKS

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
879 bp292 aa3431221+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

FFRRCVEETGPLQPQKLIDDSLQISVSKQAKLLKVSRGCYYYRPKPVSASDLKLMRCIDELHMQYPFAGSRMMRDLLNRQGHHIGRRHTRTLMKKMGINA
LYRKPNLSQANQAHRKYPYLLKGLNIQRSNQVWATDITYIPMAKGFVYLCAVIDWHSRKVLAHSVSISMEVAFCIETLNEAIEKYGRPEIFNTDQGSQFT
SDAFIEVLKSNDIQISMDGKGRWVDNVMIERLWRSVKYEEVYLKAYSNVFDAKKQLNAYFEFYNLKRPHSSLDKMTPDEFYYDQLPQQNKVA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1145 bp381 aa771221+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MEYFMARRPRRNHSNDFKAKVALAAIKAEKTLAELSAEFDVHQNQIIDWKNQLLSASSQAFDQSKAPAEPPIDLKKLHAKIGEQALEIDFFRRCVEETGP
LQPQKLIDDSLQISVSKQAKLLKVSRGCYYYRPKPVSASDLKLMRCIDELHMQYPFAGSRMMRDLLNRQGHHIGRRHTRTLMKKMGINALYRKPNLSQAN
QAHRKYPYLLKGLNIQRSNQVWATDITYIPMAKGFVYLCAVIDWHSRKVLAHSVSISMEVAFCIETLNEAIEKYGRPEIFNTDQGSQFTSDAFIEVLKSN
DIQISMDGKGRWVDNVMIERLWRSVKYEEVYLKAYSNVFDAKKQLNAYFEFYNLKRPHSSLDKMTPDEFYYDQLPQQNKVA

 

Blast result :
Comments
ISAlw27 is 97% aa (transposase) similar to ISAba14.
The third ORF is the putative ORFAB transposase reconstructed in silico by possible -1 frameshift.
Acinetobacter lwoffii EK30A plasmid pALWEK1.1 carries 2 identical copies of ISAlw27.
References
1] Janos Kiss (2019) Direct submission.