ISH27-2

  • Family ISH3
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s) ISH61
Accession numberTranspositionOriginHost
X54433 Y Halobacterium salinarum
Halobacterium sp. SB3
Halobacterium salinarum PHH1 plasmid pHH1
DNA section
IS Length : 1389 bp

Ends


IR Length : 16

IRL : CAGTACATCACAAAGCCGCTTAGTTAGAACGTCTGCTTGCTGAAGGTGTG
IRR : CAGTACCTCACAAAGCATCGCCGGCTAATCCGACTTGAGCCATCTGTTCT

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNNNNNNNATTCTNNNNNNNNNN5
NNNNNNNNNNAGAGTNNNNNNNNNN5
NNNNNNNNNNAACCTNNNNNNNNNN5
NNNNNNNNNNAGTATNNNNNNNNNN5
NNNNNNNNNNAGTCCNNNNNNNNNN5
NNNNNNNNNNAAGCTNNNNNNNNNN5

DNA sequence

CAGTACATCACAAAGCCGCTTAGTTAGAACGTCTGCTTGCTGAAGGTGTGTCTACGACCCAGCAAGCAGACAGTGAGATTCACGAGGACCAGCTCCTTAA
CTTCCTCGTCAACTGCCTTGACGAGGAAGTTTCTCTCAACCTCGCCAACAACGCTGAAATCGGTGCAGAGGACATCTACGAGGTCCTCGTCGGCGCGACC
GCCGACGGGACCTCGATCTCGACGCTGTGCAACTCCAGTGAAGACTCCCCATCGGCGAACACGATTCTCTATCATCTACGGACGAAGTTCGAGCCGGAAC
GGCTCGAACGCGTCGCTAACACGCTTCTTCGCCGAGACATCGTCGAACTGCTCCCCGAGCAGGTGGAGGTCTGCGCAGACCTCCACCTGCGGCCCTACTA
CGGTGATGAAGACGACACGGAGAACCTCTATCACTCCGAGGCGAAGCGAGGAACCACCGCATTCCACGCCTACGCCACACTCTACGCGCGTGTGAAGAAC
AAACGCTACACGCTGGCGGTCCGCCGTCTCGAAGACGGCGACACCGCCAGCAGTGTCCTCGCTGAGTTCCTTGGTGTACTCGACGGCCTTGACACCGACG
TCAAGGCCGTCTATCTTGATCGCGGATTCTACGACAGCAAGTGTCTCACGCTGTTACAGACGCACAACTACGCCTACGTTGTCCCGATCATCCGGTGGGG
TGAAGCGATTCAGCAGGAACTCTCGGAAGGGTGGAGTCGCGTCATCCAACACGATCTGACGGGGAAACTCGACGGTCACAGCTGGACCGTCGAGTTTCCC
GTCTACATCGACTGTACGTACCTGAACGGACGGTACGACGAGCACGGCGTGGCGCGTCACGGCTACGCCGCTGACGCGCCGTTCATCGAGAATCCACGCG
ACGCTCGATACCACTACTCGAAACGGTTCGGTATCGAGTCGAGCTATCGGTTGTCTGAGCAAGCGATAGCGACGACAACGACGCGAGACTCCACGGTGAG
ACTGCTGTACGTCGTGGTGAGTCTGCTGTTGCAGAACACGTGGCGGTATCTGCACTACGAATACGTGGCGACGCCGCGCCGAGGCGGGCGTCGCCTCTGG
TGGTGGCCGTACAAGGAGTTCGTGAATATGGTTCGACGGGCAGCGTGGACGGCCCTCGCGGTGCGTCGGGCCGTCCCCGCCGACCGGCCACCAGACGACC
GGTTCCACCGGTAGTCACCCACCGAGTACGGCGTCTCCGCAAGTGGCAACGCTGTCGCGTCGGCGGCTGAGCGCCGCCGACAGCGACACGTCCGCCTTCG
ATCAGCGTTGCTCAACCGTGATCGACGACTCACCACAACAGAACAGATGGCTCAAGTCGGATTAGCCGGCGATGCTTTGTGAGGTACTG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1167 bp388 aa481214+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSTTQQADSEIHEDQLLNFLVNCLDEEVSLNLANNAEIGAEDIYEVLVGATADGTSISTLCNSSEDSPSANTILYHLRTKFEPERLERVANTLLRRDIVE
LLPEQVEVCADLHLRPYYGDEDDTENLYHSEAKRGTTAFHAYATLYARVKNKRYTLAVRRLEDGDTASSVLAEFLGVLDGLDTDVKAVYLDRGFYDSKCL
TLLQTHNYAYVVPIIRWGEAIQQELSEGWSRVIQHDLTGKLDGHSWTVEFPVYIDCTYLNGRYDEHGVARHGYAADAPFIENPRDARYHYSKRFGIESSY
RLSEQAIATTTTRDSTVRLLYVVVSLLLQNTWRYLHYEYVATPRRGGRRLWWWPYKEFVNMVRRAAWTALAVRRAVPADRPPDDRFHR

 

Blast result :
Comments
ISH27 have been isolated through their inactivation of the bacteriorhodopsin (BR, bop) gene (Pfeifer et al., 1985). ISH27-1 is more similar to those of ISH51-1, ISH51-2, and ISH51-3 (88 % DNA identity), than to ISH27-2 and ISH27-3 (80 % identity). ISH27 transposition "bursts" occur after storage at 4¡C (> 2 years), but no transposition is observed upon continuous cultivation at 37¡C (3 months) (Pfeifer and Blaseio, 1990).
References
1] Pfeifer, F., Boyer, H.W., and Betlach, M.C. (1985) J. Bacteriol. 164, 414-420.
2] Pfeifer, F. (1986) System. Appl. Microbiol. 7, 36-40.
3] Pfeifer, F., and Blaseio, U. (1989) J. Bacteriol. 171, 5135-5140.
4] Pfeifer, F., and Blaseio, U. (1990) Nucl. Acids Res. 18, 6921-6925
5] Pfeifer, F., and Ghahraman, P. (1993) Mol. Gen. Genet. 238, 193-200.