ISH5

  • Family IS4
  • Group ISH8
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AF016485 ND Halobacterium sp.
Halobacterium sp. NRC-1 plasmid pNRC100
Halobacterium salinarum R1 plasmid pHS1
Halobacterium sp. NRC-1
Halobacterium salinarum R1 plasmid pHS2
DNA section
IS Length : 1442 bp

Ends


IR Length : 19/20

IRL : CATCCGTTCTAGTTTAGTGGAGAATCCTGTCGCTATCTGCTGATTAGATA
IRR : CATTCGTTCTAGTTTAGTGGCGGCCAAAGCCGAACTCACCTCGTTCAACC

Insertion site


Left flankDirect repeatRight flankDR Length
TGGATTGTTCATCTGGTGGTGTATCTGTTA10
TGGATTGTTCATCTGGTGGTGTATCTGTTA10
TGGATTGTTCATCTGGTGGTGTATCTGTTA10
TGGATTGTTCATCTGGTGGTGTATCTGT8

DNA sequence

CATCCGTTCTAGTTTAGTGGAGAATCCTGTCGCTATCTGCTGATTAGATATCGTCGCAACTACCCGGTTGAGGAACCCGGTGGGAAGTGTGTACTCTCCA
CCGGACTCGGTAGTTGTTGACCGAATTCAAAGAGCGTTTCCCTCTGATGAGTTGCGCGAGCGCGCTCGCGCAACGAATCTCGTTGAGCGTGAGCGGAAGT
TCGACATCGTTGCGCTGTTTTACACACTCTCGTTTGGCTTCGCTGCTGGCTCAGACCGCTCTCTGCAAGCATTTCTCGAACGCTATGTCGAGATGGCTGA
CTGCGACGACCTCTCTTACGCGGCGTTCCACGACTGGTTCGAACCGGGGTTCGTTGCACTCCTTCGAGAGATTCTCGATGATGCTATCGAGAATCTCGAT
ACTGGACGAGCCGACTTGAGCGGACGTCTCGAACGCTTTCGAGACGTCCTCATTGCTGACGCGACTATTGTTTCGCTGTATCAAGACGCCGCTGATGTCT
ACGCCGCAACCGGCGAAGACCAGGCTGAACTGAAACTCCACCTCATCGAGTCACTCTCGACAGGTCTTCCAACACGGTTCCGCACAACCGACGGCACGAC
TCACGAACGGAGTCAGCTACCCACCGGAGAGTGGGTAGCTGACGCCCTCATCCTGCTTGATTTGGGCTTCTACGATTTCTGGTTGTTCGATCGTATCGAC
CAGAACGGCGGCTGGTTCGTCTCCCGCGTCAAGGACAACGCGAACTTCGAGATTGTCGAAGAACTGCGGACTTGGCGAGGCAACAGCATTCCGCTGGAAG
GAGAGTCGCTGCAGGCCGTCCTCGACGACCTGCAGCGACAGGAGATCGACGTCCGCATCACGCTTTCATTCGAGCGCAAACGAGGGTCGGGCGCCAGCGC
GACCCGGACGTTTCGACTGGTCGGCCTGCGCAACGAGGAGACCGAAGAGTACCATCTGTATCTGACGAATCTCGGCAACGACGACTACAGCGCGCCCGAT
ATCGCGCAGCTCTATCGGGCGCGCTGGGAGGTCGAACTGCTGTTCAAGGAGTTGAAGTCGCGGTTCGGCCTGGACGAGATCAACACGACCGACGCCTACA
TCATTGAGGCGCTGATCATCATGGCGGCAATTTCGTTGATGATGAGTCGTGTGATCGTGGATGAGTTACGGTCGCTTGAGGCAAGACAGCGTGAGGTCGA
AGCCGCCGCAGACGCCGACGAGTCGGCGTCGCGGCTCCCTCGCCGTCGCTGTTCGCTAGCCGTTGAACGGCACGCTCATCTGATCCAGCTGTATCTCATG
GTCGAGTTGGGCTACGAACTGCCGGATTTGGACGAACTGTTGCTGTGGGCATCACGAAATCCAAATCCACACAGAGATCGGTTACGTGAGCAGGTTGAAC
GAGGTGAGTTCGGCTTTGGCCGCCACTAAACTAGAACGAATG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1350 bp449 aa801429+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MGSVYSPPDSVVVDRIQRAFPSDELRERARATNLVERERKFDIVALFYTLSFGFAAGSDRSLQAFLERYVEMADCDDLSYAAFHDWFEPGFVALLREILD
DAIENLDTGRADLSGRLERFRDVLIADATIVSLYQDAADVYAATGEDQAELKLHLIESLSTGLPTRFRTTDGTTHERSQLPTGEWVADALILLDLGFYDF
WLFDRIDQNGGWFVSRVKDNANFEIVEELRTWRGNSIPLEGESLQAVLDDLQRQEIDVRITLSFERKRGSGASATRTFRLVGLRNEETEEYHLYLTNLGN
DDYSAPDIAQLYRARWEVELLFKELKSRFGLDEINTTDAYIIEALIIMAAISLMMSRVIVDELRSLEARQREVEAAADADESASRLPRRRCSLAVERHAH
LIQLYLMVELGYELPDLDELLLWASRNPNPHRDRLREQVERGEFGFGRH

 

Blast result :
Comments
Two copies are present in pNRC100 and two in pNRC200 of Halobacterium sp. NRC-1. All copies are interrupted by ISH11. The ISH5 sequence was constructed by deletion in silico of ISH11 seq. and one of ISH11-DR.
ISH5 is 57% aa similar to ISH8E transposase of Halobacterium sp. NRC-1.
File update: June 03 2010.
References
1] Wailap V. Ng., Stacy A. Ciufo, Smith T.M., Bumgarner R.E., Baskin D., Faust J., Hall B., Loretz C., Seto J., Slagel J., Hood L., and DasSarma S. (1998) Genome Research 8, 1131-1141

2] Pfeiffer F., Schuster S.C., Broicher A., Falb M., Palm P., Rodewald K., Ruepp.A., Soppa J., Tittor J., Oesterhelt D. (2008) Genomics 91: 335-346