ISPg4

  • Family IS4
  • Group IS4Sa
MGE type ISRelated element(s) :
Isoform IS1598Synonym(s)
Accession numberTranspositionOriginHost
AF148127 ND Porphyromonas gingivalis
Porphyromonas gingivalis
DNA section
IS Length : 1395 bp

Ends


IR Length : 20/23

IRL : CATTAGTGTCCTAAAAGCTATTTTGGCAAAAGATTAGGAGAGGTACTTCA
IRR : CATTAGTGTCCTAAAAGTTTCTTCTTGAGGCATAGGGATCCTTAGTCCTG

Insertion site


Left flankDirect repeatRight flankDR Length
GCTAAGCAGTACTTCGAACATAAAAAAGC9

DNA sequence

CATTAGTGTCCTAAAAGCTATTTTGGCAAAAGATTAGGAGAGGTACTTCACAGCACCTCTCCTTTCGTCTATTATCAGAGCCACCTAAGGTAAATCATCT
TACCTTGGGTATATTCCACAAAAAAACTCTGATGAGTACAAATATAAGCCTATTCGCCCAAGTTATCCGCCTGTTGCCTCGTCCATTGATTAAGAAGCTC
TCTACAGAGTTTCAGGTAGACAAGCACAGCAAGCATTTCACCTCATGGCAGCACTTAGTGAGCATGATTTTCAGCCAATTCTCAAGCTGTATCTCCTTAC
GCGAGATTAGTAATGGCTTACGCTCAGCCACAGGTAACCTCAACCACTTAGGCATATGCACAGCACCCTCTAAGTCCAATTTATCTTATCAGAACGAGCA
CCGTACCTCAGACTTCTTTCGAGCGTGCTATTATGCCTTGCTAGATTATTTCGGACAGCAGGGTATGGGGCAAGGGCGTAAGTTTCGTTTTAAGCAACCC
GTCAAGCTTCTAGACTCTACGACCATTACCCTTTGCCTTGCCCTATACGATTGGGCTAAATACACACATACGAAGGGAGCTGTTAAGCTTCATACACTCT
TAGACTTCAAGACTCTGTTGCCTGAATATGTGCATATTAGTGATGGTAAAGGACATGATGGCAAGATGGCCAATTCTATTCCTATCCCAGCAGGAAGTAT
CGTCGTGGCTGACCGTGGCTATGCTGATACCGCCTTGCTCAATAGTTGGGACAGCACCCAAGTGAGTTTTGTAGTACGCCACCCAAGGTCCTTAAAATAT
GAGGTTATTCAAGAGTTGGAACTCCCAGAACATGGGCATCAGCAAATACTCGTAGATCAGAGAGTACGGCTCACAGGCGTTCAGACGCAAGGCAAGTACA
CTAAGCCATTGAGGCATATTGCCCTCTACAACGAGCAACATGGCGATGTCGTTGAGTTATTGACCAACATAGACACCCTTGCAGCAAGTAGTATAGCCTT
GCTGTATCGTTCAAGATGGCTTATCGAGATTTTCTTTCGGAATTTGAAGCAACGCCTCAGCATGAAGGCCTTTCTTGGAACAACGCGCAATGCCGTAGAG
GTGCAAATATGGACGGCTCTTATTACAATGCTTTTGATGGTCTATCTCAAGAGTATCGCCAAATATCGGTGGTGCTTGTCTAATCTTGTCTCTTCGCTAA
GAATCAACACATTTACCAAGATGGATCTGATGCAATGGCTTAATGAGCCGTTTACGCCTCCGCCAGAGCCCGAAAATCAGCTCTTTTAGCACATAGGGGG
ATGACCACATTTCGAAAAATTGATAGTCAGGGGGCTAATCCGCTCCAGGACTAAGGATCCCTATGCCTCAAGAAGAAACTTTTAGGACACTAATG
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1158 bp385 aa1311288+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MSTNISLFAQVIRLLPRPLIKKLSTEFQVDKHSKHFTSWQHLVSMIFSQFSSCISLREISNGLRSATGNLNHLGICTAPSKSNLSYQNEHRTSDFFRACY
YALLDYFGQQGMGQGRKFRFKQPVKLLDSTTITLCLALYDWAKYTHTKGAVKLHTLLDFKTLLPEYVHISDGKGHDGKMANSIPIPAGSIVVADRGYADT
ALLNSWDSTQVSFVVRHPRSLKYEVIQELELPEHGHQQILVDQRVRLTGVQTQGKYTKPLRHIALYNEQHGDVVELLTNIDTLAASSIALLYRSRWLIEI
FFRNLKQRLSMKAFLGTTRNAVEVQIWTALITMLLMVYLKSIAKYRWCLSNLVSSLRINTFTKMDLMQWLNEPFTPPPEPENQLF

 

Blast result :
Comments
99% aa homologous with IS1598.
References
1] Jackson,C.A. and Reynolds,E.C. (1999) Direct submission GenBank.