ISPpu3

  • Family IS630
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AJ233397 ND Pseudomonas putida
Pseudomonas putida P1
DNA section
IS Length : 1135 bp

Ends


IR Length : 3

IRL : TGTGCATCCCTCCTTTTTCGGCGTCTGTAGCATGGCTCGACCAGCGGCTT
IRR : TGTTTGGTTAGTTCAATAACTTATTCTTGATTGCGGTGAGCTTTGCGCGA

Insertion site


Left flankDirect repeatRight flankDR Length
ACAAATATACGTCCGCTTGG0

DNA sequence

TGTGCATCCCTCCTTTTTCGGCGTCTGTAGCATGGCTCGACCAGCGGCTTCTTTTTGTTTAAAACCCACTGATGTTGAGACGCTGCAAAGCTGGTTATGC
ATGGGAACTCTGCCGCAAAACCTTGGGCAACGTGCCCGAGTTCTGTTGCTGCTGGCCAGCGGTCTCACGCCCAAGCAGGTAAGTGATCGGTTGGAAGTTT
CGGCACCTGTCGTATTCAAATGGCGCAAGCGCTATCAGGAAGCTGGCCTCGATGGGCTGAGCGATCTCCCGCGTAGCGGACATCCACGCAAGCTCGACGA
GGCGAAGATTAAGGAAATCCTCACCCTGACGACCCAGCGTGTACCGCGTGAGGCGACACACTGGAGCCTGCGCCTGATGGCCAAATACGTGGGCGTTACC
GTCTGGCAAGTCGCCCAGGTATGGGCCGCTGCCGACCTCAAGCCCCACCGGCTGAAGACCTTCAAGATCAGCAACGACCCACACTTTGCTGGCAAAGTGG
TCGATGTGGTTGGGCTGTACCTGAACCCGCCTGACAATGCGATGGTGCTGTCAGTGGGCGAGAAAACCCAGATCCAGGTGCTGGATCGCACCCAGCCCAT
GCTGCCGCTCAAGCCGGGTCAGATCGAACGCAGGACGCATGACTACAAGCGTCACGGTACGGCCAGTTTGTATGCCGCCTTCGACATCCTGACGGGCCAG
GTCATTGGTCGCATCGCATCACCCAACGACACAGGGCCAAAGAGTTCCTTGAATTCTTGCGACAGATCGACCGCGCGACGCCTGCCGAGCTGGATCTGCA
TTTGATTCTGGACAACAGCTCGACTCACAAGACAGCCGCCGTCAGGGCATTGCTGGAGAGGCATCCCCGCTTCAAGCTGCACTTCACGCCGACCAGTGCC
TCATGATTGAACGCCGTAGAGGGTTGGTTTACTCAATTGGAACGGCGGGCGCTGTATCGCAATGCGTTCAGCAGCGTGGCGGATCTGAAAGCGGCAATTC
GCCGTTTTATCGAAGCCCATAATGAACATTCAGCCAAGCCATTTCGCTGGAACAAAACGGCTGAATCCATCATCAACTCTGTTAGTCGCGCAAAGCTCAC
CGCAATCAAGAATAAGTTATTGAACTAACCAAACA
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
1094 bp363 aa321125+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MARPAASFCLKPTDVETLQSWLCMGTLPQNLGQRARVLLLLASGLTPKQVSDRLEVSAPVVFKWRKRYQEAGLDGLSDLPDARSGHPRKLDEAKIKEILT
LTTQRVPREATHWSLRLMAKYVGVTVWQVAQVWAAADLKPHRLKTFKISNDPHFAGKVVDVVDAGLYLNPPDNAMVLSVGEKTQIQVLDRTQPMLPLKPG
QIERRTHDYKRHGTASLYAAFDILTGQVIGRITQRHRAKEFLEFDALRQIDRATPAELDLHLILDNSSTHKTAAVRALLERHPRFKLHFTPTSASWLNAV
EGWFTQLERRALYRNAFSSVADLKAADAIRRFIEAHNEHSAKPFRWNKTAESIINSVSRAKLTAIKNKLLN

 

Blast result :
Comments
ISPpu3 is located next to ISPpu2, between alkS and alkB, genes involved in alkane degradation by Pseudomonas putida P1. The TnpA open-reading-frame has two frameshifts, which implies that IS pep 1 is not produced.
ISPpu3 is 86% aa similar to ISPpu2 and 64% to ISPsy1.
References
1] van Beilen, J. B., Röthlisberger, M. and Witholt, B. Direct submission.
2] van Beilen,J.B., Panke,S., Lucchini,S., Franchini,A.G., Rothlisberger,M. and Witholt,B. (2001) Microbiology 147 (Pt 6), 1621-1630