ISRl2

  • Family IS5
  • Group IS1031
MGE type ISRelated element(s) :
Isoform Synonym(s) ISRlF7-2
Accession numberTranspositionOriginHost
Z37965 Y Rhizobium leguminosarum
Sinorhizobium meliloti
Rhizobium tropici
Rhizobium leguminosarum biovar viciae MSDJ4184
Rhizobium etli
Rhizobium galegae
Sinorhizobium fredii
DNA section
IS Length : 932 bp

Ends


IR Length : 14/17

IRL : GAGCCTGACCGAAAAAGAGTTGAGTGAAATCAGCCAGTTGTGATTCTGTT
IRR : GAGCCTGACTCGAAAAGGTTTCAACGATATCCGTACCTTGCCAAGCGTCG

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNNNNNNNTTANNNNNNNNNN3

DNA sequence

GAGCCTGACCGAAAAAGAGTTGAGTGAAATCAGCCAGTTGTGATTCTGTTTGTTTGCTTAGGACGAACGGAGACCACAATGGGCTGGACTGATTTCACCC
GTCGGCAATATGCCCGACGCACAGTGCGGTATGCAAGCGATCTGACGGACCGGGAGTGGGGATTGATCTCGCCTTGCCTGCCTGGACCGAGGCGGTTGGG
CAGGCCGCGCAGTACCGATCTTCGCGAGGTGGTGAATGCGTTGCTTTACATCGCCACGACGGGGTGCCAGTGGCGGATGATGCCCAGAGATTTCCCACCT
TTTACAACTGTGCAGTCCTATTTCTATGAATGGCGAGCGACAGGGTTATGGGGTCGGATCAACCATCATCTTGTGATGGAGGCGCGTGACTTGGAAGGTC
GGGAAGCCTCGCCGTCTGCGGGCGTGATCGACAGTCAAAGCGTGAAAACCACGGAAAGCGGCGGAATTTCGGGCTATGACGCGGGCAAGAAGATAAAGGG
ACGCAAGCGTCATATCGTCGTCGACACGCTCGGACTGATGGTCGGCCTCATGGTTCACAGCGCCGATATTCAGGATCGCGACGGCGCGCCTGCCGTTCTC
AAAACCATTCTCAAGCGCTGGCCGTGGCTGAGACATATCTTCGCCGATGGTGGTTATGCCGGATCGAAGCTGAGGGGCGCACTGCAAAAGATCGCTGCGT
TCACTCTCCAGATCGTCAAGCGGACCGACAAGGCCAAGGGCTTCGAGGTTCTGCCGCGTCGCTGGGTAGTGGAGCGCACCTTCGCATGGCTTGGCAGATG
CCGACGATTGGCGAAGGATTGGGAAAAGTCCGTCGCCTCAGCCGAGGCCTGGGTCACTATCGCCCACATCCGGGTCCTGACACGACGCTTGGCAAGGTAC
GGATATCGTTGAAACCTTTTCGAGTCAGGCTC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
873 bp290 aa40912+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MILFVCLGRTETTMGWTDFTRRQYARRTVRYASDLTDREWGLISPCLPGPRRLGRPRSTDLREVVNALLYIATTGCQWRMMPRDFPPFTTVQSYFYEWRA
TGLWGRINHHLVMEARDLEGREASPSAGVIDSQSVKTTESGGISGYDAGKKIKGRKRHIVVDTLGLMVGLMVHSADIQDRDGAPAVLKTILKRWPWLRHI
FADGGYAGSKLRGALQKIAAFTLQIVKRTDKAKGFEVLPRRWVVERTFAWLGRCRRLAKDWEKSVASAEAWVTIAHIRVLTRRLARYGYR

 

Blast result :
Comments
ISRl2 putative transposase is 80 % identical to that of ISRm4. ISRl2 is nearly identical to ISRlF7-2 described in Simon et al. (1991).
References
1] Simon, R., Hätte, B., Klauke, B., and Kosier, B. (1991) J. Bacteriol. 173, 1502- 1508.
2] Mazurier, S.-I., Rigottier-Gois, L., and Amarger, N. (1996) Appl. Environ. Microbiol. 62, 685-693.