ISRru1

  • Family IS3
  • Group IS51
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
AF333761 ND Rhodococcus ruber
Rhodococcus ruber
DNA section
IS Length : 1345 bp

Ends


IR Length : 23/26

IRL : TGAACCACCCTGGGGCTGGTGGAGACTGTGATCTCACCAGGAGAATGCAG
IRR : TGAACCACCCTGGATCTGATGGAGACCTGGTTCAAGCCACGTCGCGGTCG

Insertion site


Left flankDirect repeatRight flankDR Length
GGCACGCGAACTCGTCGCGTGGC3

DNA sequence

TGAACCACCCTGGGGCTGGTGGAGACTGTGATCTCACCAGGAGAATGCAGATATGGGTGCACCAAGGAAGTTCGATGCTGAGACGCGGGAGCGGGCAGTT
CGGATGTATCGCGACCGGCTCAAGGAGTACGGCGAGCCGAAAGTAACGGCCCGTAAGCACGTCGGGGCTCTGCTCGATATCAACCCGGCGACGATCCGAA
ACTGGATCGAGAAGAACGATCCGGCCACCGAGGCACACGGGCCCGTCGCAGGAGTTGACCGCGACGAGGAGTTGAAGGCGCTACGGCGTGAGAACTCCGA
ATTGCGAAGAGCCAACGAGATTCTCAAGACAGCGTCAGCGTTTTTCGCAGCGGCGGAGGTCGACCGCCGACTTCGGTGATCGTCGAGTACATCGACGAAT
ACCGCCACCTTTTCGGGGTCGACCCGATCTGCACCGTACTCAAAGAGCACGGCATCAAGATCGCCCCGTCCACCTACTACGCCGCCAAGAAACGCGGCAC
CGTCTCCGCAGCGGCACTGGAAGAGGCGTACGCCACGAACACCGTTCACGGGTTCTTCGTGGCAAACAGACGCCTCTACGGAGCCAAGAAAATCTGGCAT
GCAATGAAACGCGCTGGTCACGAGATCGGCCGCGATCAGGTCGCTCGGTTGATGACGATCTGCGGAGCAGAGGGTGTTGTCCGCGGACGCCGGCGTACGG
TGACCACCGAACGCGATGATCGTGCCCCTCGACATCCGGATCTGATTGCCCGGCAGTGGGGCGCGCCGACTCAACCGGACCAGTGGTGGGTTGCCGATTT
TACTTATTGCTGGACGTTGGTTGGTTTCGTGTACACCTCGTTCGTGGTCGATGTGTTCTCCCGCCGGATTCTCGGGTGGAGGGTCATGACGACGAAGGCG
ACGCCGCTGGTGTCGGGTGTACTCGAGCAAGCATTGTTCACACGTCGCCGGTCCGACTTCGCGTTCACTGCAACGGGTTTGGTCCATCACTCGGACGCGG
GTTCCCAGTATACGTCTCTGGCGTTCACCGAGGCGTTGATCGAATCCGGCATCGCTGGATCGATCGGCAGCGTCGGCGACGCGCTCGACAATGCGTTGAT
GGAATCGACGATCGGGTTGTACAAGACCGAGCTGATCGACCGGCAGAAGTCGTGGAGCGGGCGCAGCGAGGTCGAGCGCGAGACGGCTTCCTGGGTGCAT
TGGTTCAACACCAGCCGCCTGCACTCCTCGATCGGATACCAACCGCCCATCGACTACGAAAACGAGTACCGTCAACAACGCTCGACAGCCACCTCCGACC
GCGACGTGGCTTGAACCAGGTCTCCATCAGATCCAGGGTGGTTCA
Recoding section
  • Recoding by frameshift
  • Frame
  • Type
  • Experimentally demonstrated

Stimulators :

  • Shine-Dalgarno sequence :
  • Secondary structure :

Recoding motif :

Protein section
ORF number : 3

 

ORF 1
LengthBeginEndStrandFusion ORF
327 bp108 aa53379+No
ORF function : Transposase
Description : First part of the transposase

ORF sequence :

MGAPRKFDAETRERAVRMYRDRLKEYGEPKVTARKHVGALLDINPATIRNWIEKNDPATEAHGPVAGVDRDEELKALRRENSELRRANEILKTASAFFAA
AEVDRRLR

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
1026 bp340 aa2891314+No
ORF function : Transposase
Description : Second part of the transposase

ORF sequence :

ELRIAKSQRDSQDSVSVFRSGGGRPPTSVIVEYIDEYRHLFGVDPICTVLKEHGIKIAPSTYYAAKKRGTVSAAALEEAYATNTVHGFFVANRRLYGAKK
IWHAMKRAGHEIGRDQVARLMTICGAEGVVRGRRRTVTTERDDRAPRHPDLIARQWGAPTQPDQWWVADFTYCWTLVGFVYTSFVVDVFSRRILGWRVMT
TKATPLVSGVLEQALFTRRRSDFAFTATGLVHHSDAGSQYTSLAFTEALIESGIAGSIGSVGDALDNALMESTIGLYKTELIDRQKSWSGRSEVERETAS
WVHWFNTSRLHSSIGYQPPIDYENEYRQQRSTATSDRDVA

 

Blast result :
ORF 3
LengthBeginEndStrandFusion ORF
1262 bp420 aa531314+Yes
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MGAPRKFDAETRERAVRMYRDRLKEYGEPKVTARKHVGALLDINPATIRNWIEKNDPATEAHGPVAGVDRDEELKALRRENSELRRANEILKTASAFFRS
GGGRPPTSVIVEYIDEYRHLFGVDPICTVLKEHGIKIAPSTYYAAKKRGTVSAAALEEAYATNTVHGFFVANRRLYGAKKIWHAMKRAGHEIGRDQVARL
MTICGAEGVVRGRRRTVTTERDDRAPRHPDLIARQWGAPTQPDQWWVADFTYCWTLVGFVYTSFVVDVFSRRILGWRVMTTKATPLVSGVLEQALFTRRR
SDFAFTATGLVHHSDAGSQYTSLAFTEALIESGIAGSIGSVGDALDNALMESTIGLYKTELIDRQKSWSGRSEVERETASWVHWFNTSRLHSSIGYQPPI
DYENEYRQQRSTATSDRDVA

 

Blast result :
Comments
There is a putative -1 ribosomal frameshift at position 343-346. ISRru1 is 45% aa similar to IS1076 and 59% aa similar to the ORF2 of IS1416.
References
1] Chauvaux,S., Chevalier,F., Le Dantec,C., Fayolle,F., Miras,I., Kunst,F. and Beguin,P. (2001) J. Bacteriol. 183 (22), 6551-6557