ISRso18

  • Family IS5
  • Group IS5
MGE type ISRelated element(s) :
Isoform Synonym(s)
Accession numberTranspositionOriginHost
NC_003295 ND Ralstonia solanacearum
Ralstonia solanacearum
DNA section
IS Length : 1188 bp

Ends


IR Length : 16/18

IRL : GGATGGTGTTCAGAACTCACTCCGTCGCACCGAGTCATCGATGCAGAGCC
IRR : GGATGATGTTCAAAACTCCCGCAAACCCGGACAGTCAAAGGAAGGTTCGC

Insertion site


Left flankDirect repeatRight flankDR Length
GCGCTTTTTCATGGAATTAGAGGCCAAGACCAATTC4

DNA sequence

GGATGGTGTTCAGAACTCACTCCGTCGCACCGAGTCATCGATGCAGAGCCGACGCAGTGCAAACGATGTGATGGCGAGCTCGAATACAGCGTCGTGTTCA
GCCTGAAGGCGGGCCGGTTTCTGGCTCCTGGGCAGCTTGGCCAATGGCCGGCGCACTCATGCGCGGGCCTCACCCATCAGTCGCCCGCGCATCATCCACA
GGTTGCTCAGGGCGAACAGCGTGTGCAACTGTTGCGTGTTCTTCATCAAGCCGCGATAGCGAACCTTCAGATGCCCGAACTGGCGCTTGATGACACGAAA
CGGATGTTCCGCGCGGGCACGGATGCGCGCCTTGACCCGTTCCAGTTCATCAACGAGCTTGCCCAGCGCGGTGTTCTTGTCCAAGGCGCGGCGCTTGCCC
GGGCGCAATGCCACATGCCAACGCACCTTCAGCTTCTGCACTTCCTCGCGCTTGTCGATGCCCTGGTAGCCGGCATCGCCGAACACATCGGCCTCCTTGC
CATGCACCAGAGCATGCGCTTGCGTAACATCGTTGACGTTGGCCGCCGTGCCCACCACGGTATGCACCAGCCCCGAGTCTGCATCCACACCGATGTGCGC
CTTCATGCCGAAATGCCACTGGTTGCCTTTCTTGGTCTGGTGCATCTCAGGGTCGCGCTCGCCGCTTTGGTTCTTCGTCGAGCTGGGCGCGGAAATCAGC
GTGGCATCGACCGCCGTGCCCTCTTTGAGCAGGTACCCCTTGGCACTGAGTTGCTCGTTGACGGTCTGCAGAAACTGCTCGGCCAGCTTGTGCCGCTCCA
GCAAGTGCCGGAAGCGCAGAATGCTGACCCGGTCCGGCAGCCGGCTCATGCCACCCAGACCCGCGAATTGACGATACAACGGCACGTCGTACAGCGCCTC
TTCCATCGCCACGTCCGACAGCCCGAACCATTGCTGCAACAAGTGGATGCGCAGCATCGCCTCGATTGGAAACGGCTTGCGGCCGGTCGCCTTGGTCGGC
GCATGCGGTGCTATCAGCGCCAAAAACGCCTGCCATGGCACCACGCGCTCCATCTCGTCGAGAAATACCTGCTTGCGCGTGCGCCGGTTGCTCAGGTCCA
GGCCAAGGTCGGTTTGTTTCATGGACTCATCCCGTTTCGCGAACCTTCCTTTGACTGTCCGGGTTTGCGGGAGTTTTGAACATCATCC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
966 bp321 aa611026+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MKQTDLGLDLSNRRTRKQVFLDEMERVVPWQAFLALIAPHAPTKATGRKPFPIEAMLRIHLLQQWFGLSDVAMEEALYDVPLYRQFAGLGGMSRLPDRVS
ILRFRHLLERHKLAEQFLQTVNEQLSAKGYLLKEGTAVDATLISAPSSTKNQSGERDPEMHQTKKGNQWHFGMKAHIGVDADSGLVHTVVGTAANVNDVT
QAHALVHGKEADVFGDAGYQGIDKREEVQKLKVRWHVALRPGKRRALDKNTALGKLVDELERVKARIRARAEHPFRVIKRQFGHLKVRYRGLMKNTQQLH
TLFALSNLWMMRGRLMGEARA

 

Blast result :
Comments
There are 2 copies on Ralstonia solanacearum genome (1 on chromosome and 1 on megaplasmide).
ISRso18 is 90% DNA and 95ù aa similar with IS1405.
References
1] Salanoubat,M., Genin,S., Artiguenave,F., Gouzy,J., Mangenot,S.,Arlat,M., Billault,A., Brottier,P., Camus,J.C., Cattolico,L., Chandler,M., Choisne,N., Claudel-Renard,C., Cunnac,S., Demange,N., Gaspin,C., Lavie,M., Moisan,A., Robert,C., Saurin,W., Schiex,T., Siguier,P., Thebault,P., Whalen,M., Wincker,P., Levy,M., Weissenbach,J. and Boucher,C.A. (2002) Nature 415 (6871), 497-502