ISRsp2

  • Family IS21
  • Group
MGE type ISRelated element(s) :
Isoform Synonym(s) NGRIS-3
Accession numberTranspositionOriginHost
AE000081 ND Rhizobium sp.
Rhizobium sp. NGR234 plasmid pNGR234a
DNA section
IS Length : 2623 bp

Ends


IR Length : 12/16

IRL : TGCGGGTTTCGGCAAAGTCCGGACAGGATTTCCGGTAATCTCCGGACACA
IRR : TGCGCGCTTCGCAAAAACTGGACATTGATTCCGCTAAATCCCGGACAGCA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

TGCGGGTTTCGGCAAAGTCCGGACAGGATTTCCGGTAATCTCCGGACACAGTTTTCAGTAATTCCCGGACAGCGATTCCGCTAAATCCCGGACAGTTTCC
GGCGGCGGTTTGACGGGTTGGTTCGCGGCTGCGCCGTCTTGTTGGTTAGGCCTCTCACGACAACGTTGAGAGGGGCCGATGCCGAGACGGAAGCAAGCAA
GACGAACGACAGTGAGGGATATCCGGACTATTCTGCGCCTGACCCATGAAGAGGGTCTTTCGGTGCGCGAGATTGCCGAGCGGCTGAAGATCGGCAAGAG
CTCGGTATCGACCTATTTGCTGCGATCTCGGGAAGCCGGGCTTTCGTGGCCGTTGCCAATCGGCGCGGACGAGGATGCAAAGCTGGAGCGGCGGCTGTTC
GGCCGAGCCGGTCGACCGCCGCGCGATCTCAGCGAGCCGGACTGGGCGCTGGTGGTTCGGGAGCTGAAGCGCAAAGGCGTGACGCTGACGCTTCTATGGC
AGGAATACCGCGCCAGCCATCCTGATGGTTACGGCTTCACCTGGTTCTGCGAGCAGGTTGCCGCCTTTCGGCAGCGCACCAGTGTAGCGTTCCGCAATCG
GCACGCGGCGGGCGCCGTGATGCAGACCGACTATGCCGGGCCGACGGTGCCGGTGATCGATCCGGCAACCGGTGTCATCCATCCGGCCCAAATCTTTGTC
GCGGTGCTGGGCGCCTCCAACCTGACCTTCGCCCATGCCAGCTTTAGCCAGCAGTTGCCGGATTGGATCGACGGTCAGGTGCGTGCTCTGACCTTCTATG
GTGGGGTCACCAAGGCAATCGTGTGCGACAACCTCAAATCGGGGGTGGCCAAGGCCCTTTGGTTCGAGCCGACATTGACTGCGACGTTCGCCGCCATGGC
GGAGCATTACGACACCACGATCCTGCCGACCCGCAGCAGGAAACCGCGCGACAAAGGCCGGGTCGAAGGCGCGGTATTGATCGTGGAACGCTGGATTCTG
GCCCGGCTCAGGAACCGTACCTTCTTCTCGCTTGCCGCCCTCAACACGGCGATTGCCGAATTGCTCGAGGACCTGAACAACCGGACGATGCGCCATGTCG
GCAAAAGCCGCCGCGAGCTGTTCGAGGAGATCGAGCGGCCAGCCTTGAAGCCCTTGCCGGCGATACCGTTCGAATATGCGGAATGGAAGTCGGCGAAGGT
CCATCCGGACTATCATGTCGAGGTCGACAAGACCTTCTACTCGGTGCCGCATCGGCTGATCGGATGCACCCTCCAGGTGCGGCTCACCCACCGGGTGGTC
GAGATCTTCCACGACCACCAGCGTGTCGCCAGCCATGTTCGCCGCTCCCAGCGTTCCGGCCACGTCACCGTCAACGACCATATGCCCAAGGCGCATCAGC
GCTATGCCAACACCACGCCGGCCAATCTGATCGGCCGTGCGACCCAGATCGGCCCCAATGCCGCCATCCTGGTCGAACGCATGATGCGCGACAGGCCGCA
TCCGGAACAGGGATACCGCTCGGCCATGGGCATTCTGTCGCTGGCGCCGCGCTATGGATCCCAGCGCCTCGAGGCGGCCTGTGAGCGGGCGCTCACCATT
AATGCCATCACCTATTCCTCCGTCGCCTCCATCCTCAAATCCGGCCTCGACCGGGAAAGACCGCAGGCTGAACACGCGGCCCCCACGCCTGCGCATACCA
ATATCCGTGGCCGATCCTACTACCAGTGAAGGAAGCAAGAATGCTGACGAACCCCACCCTCGACCAGATGCAGGCCCTCGGGCTGACGGGCATGGCCGCC
GCCTGGCGCGAATTGACCGAGCAGTCCGGCACCAATGAGCTCAGCCGCGATGAGTGGCTCGGACTGATGCTCGACCGCGAAGTCACCCTGCGCGCCGACA
AGCGCATCCGTAACCGGCTCGCCTCCGCCAAGCTACGCTTTGCCCAGGCCTGTATCGAAGATATCGACTTCGCCGCCGCCCGCGGTCTCGACCGGCGCAA
CACCATGGCGCTCGCCCAGGGGCAATGGCTCACCGCCCACGAGGGCCTGATCATCACCGGCCACACCGGCACCGGCAAGTCATGGCTGGCCTGTGCCTTC
GGCAGGCAAGCGGCCAGGCTCGGTCACTCCGTGCTCTATGTGCGCGTGCCCCGAATGTTCGAGGAGCTCGCGCTTGCCCGCCTCGACGGCTCCTTCCCCC
GCCTCATCGACAGGCTCACCCGCGTCCAGCTCCTCATCCTCGATGACTTTGGAACCCATACGCTCTCCGATCAGCAGCGCTTTCACCTCTTCGAAATCGT
CGAGGAGCGTTATCAGCGAAAGTCCACCCTGATCACAGCTCAGGTTCCCGTGGCAAGCTGGCACGACCTTATTGCCGACAGCACGGTCGCCGACGCCATA
CTCGACCGTATCGTCCACAATGCTCACCGCATCACCCTCCGGGGCGAGAGCATGCGAAAGCAAAAAAGCGCACCCCTCTTGACTGGGGCAGAAAACGGCG
AAATCAATCAGCCCTGATGCTAACCAGGCTGCCGAGGACCAACCGCATCAAACTGTCCGGACTTTAATGAAATTGCTGTCCGGGATTTAGCGGAATCAAT
GTCCAGTTTTTGCGAAGCGCGCA
Protein section
ORF number : 2

 

ORF 1
LengthBeginEndStrandFusion ORF
1551 bp516 aa1791729+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MPRRKQARRTTVRDIRTILRLTHEEGLSVREIAERLKIGKSSVSTYLLRSREAGLSWPLPIGADEDAKLERRLFGRAGRPPRDLSEPDWALVVRELKRKG
VTLTLLWQEYRASHPDGYGFTWFCEQVAAFRQRTSVAFRNRHAAGAVMQTDYAGPTVPVIDPATGVIHPAQIFVAVLGASNLTFAHASFSQQLPDWIDGQ
VRALTFYGGVTKAIVCDNLKSGVAKALWFEPTLTATFAAMAEHYDTTILPTRSRKPRDKGRVEGAVLIVERWILARLRNRTFFSLAALNTAIAELLEDLN
NRTMRHVGKSRRELFEEIERPALKPLPAIPFEYAEWKSAKVHPDYHVEVDKTFYSVPHRLIGCTLQVRLTHRVVEIFHDHQRVASHVRRSQRSGHVTVND
HMPKAHQRYANTTPANLIGRATQIGPNAAILVERMMRDRPHPEQGYRSAMGILSLAPRYGSQRLEAACERALTINAITYSSVASILKSGLDRERPQAEHA
APTPAHTNIRGRSYYQ

 

Blast result :
ORF 2
LengthBeginEndStrandFusion ORF
792 bp170 aa17262517+No
ORF function : Accessory Gene
AG : IS21 helper

ORF sequence :

VKEARMLTNPTLDQMQALGLTGMAAAWRELTEQSGTNELSRDEWLGLMLDREVTLRADKRIRNRLASAKLRFAQACIEDIDFAAARGLDRRNTMALAQGQ
WLTAHEGLIITGHTGTGKSWLACAFGRQAARLGHSVLYVRVPRMFEELALARLDGSFPRLIDRLTRVQLLILDDFGTHTLSDQQRFHLFEIVEERYQRKS
TLITAQVPVASWHDLIADSTVADAILDRIVHNAHRITLRGESMRKQKSAPLLTGAENGEINQP

 

Blast result :
Comments
ISRsp2 is located on the pNGR234a plasmid of Rhizobium sp. NGR234, (section 18 of 46, bases 208688 to 222367). ISRsp2 IstA and IstB ORFs overlap with a start-stop configuration "GTGA".
References
1] Freiberg, C., Fellay, R., Bairoch, A., Broughton, W.J., and Rosenthal, A. (1997) Nature 387, 394-401.