ISS1D

  • Family IS6
  • Group
MGE type ISRelated element(s) :
Isoform ISS1NSynonym(s) ISS1/pTD1
Accession numberTranspositionOriginHost
X62737 ND Lactococcus lactis
Lactococcus lactis subsp. lactis W81
Lactococcus lactis subsp. lactis W67 plasmid pTD1
Lactococcus lactis subsp. cremoris AC1
Lactococcus lactis subsp. cremoris FD4
Lactococcus lactis subsp. cremoris FD50
Lactococcus lactis subsp. cremoris P8-11-35
Lactococcus lactis subsp. cremoris SK11
Lactococcus lactis subsp. cremoris Wg2-1
Lactococcus lactis subsp. diacetylactis Bu2
Lactococcus lactis subsp. diacetylactis F7/2
Lactococcus lactis subsp. diacetylactis W932
Lactococcus lactis subsp. lactis 712
Lactococcus lactis subsp. lactis 3078
Lactococcus lactis subsp. lactis ATCC11454
Lactococcus lactis subsp. lactis FA318
Lactococcus lactis subsp. lactis F7/1
Lactococcus lactis subsp. lactis K9-1-10
Lactococcus lactis subsp. lactis NIZO15
Lactococcus lactis subsp. lactis W53
DNA section
IS Length : 808 bp

Ends


IR Length : 17/18

IRL : GGTTCTGTTGCAAAGTTTTCGGAAAAATCTATTTTAGTGTAAAATTGAGA
IRR : GGTTCTGTTGCGAAGTTTGAAAATCAAACGCATTCTCTCTGAACTCCAAA

Insertion site


Left flankDirect repeatRight flankDR Length

DNA sequence

GGTTCTGTTGCAAAGTTTTCGGAAAAATCTATTTTAGTGTAAAATTGAGAAAAAAGACAGAGAGGACAGAGTAATGAATCATTTTAAAGGCAAACAATTC
AAAAAAGACGTCATTATTGTCGCTGTTGGTTACTACCTGCGTTACAATCTAAGCTATCGTGAAGTTCAGGAATTGTTATATGATCGTGGAATAAATGTTT
GTCATACTACGATTTATCGTTGGGTGCAAGAGTACAGCAAAGTCCTCTATTATCTTTGGAAGAAGAAAAATAGACAATCCTTCTATTCATGGAAAATGGA
CGAAACCTATATCAAAATTAAGGGACGTTGGCATTATCTTTATCGTGCAATTGATGCGGACGGCTTAACCTTAGATATCTGGTTACGAAAGAAACGGGAT
ACGCAAGCAGCCTATGCTTTCTTAAAACGACTCCATAAACAGTTTGGTGAGCCGAAAGCAATTGTCACGGATAAAGCACCTTCTCTTGGCTCCGCCTTTA
GAAAGTTACAGAGTGTGGGTTTATATACTAAGACAGAGCACCGAACTGTGAAGTATCTTAACAATTTAATAGAACAAGACCATCAACCTATTAAACGACG
CAATAAATTTTGTCAAAGTCTCCGTACAGCCTCTTCCACGATTAAGGGCATAAAGACCCTTCGAGGAATATATAAAAAGAACCGAAGAAATGGAACGCTC
TTCGGCTTTTCGGTGTCTACTGAAATCAAGGTATTAATGGGAATAACAGCCTAAGATATTTGGAGTTCAGAGAGAATGCGTTTGATTTTCAAACTTCGCA
ACAGAACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
681 bp226 aa74754+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNHFKGKQFKKDVIIVAVGYYLRYNLSYREVQELLYDRGINVCHTTIYRWVQEYSKVLYYLWKKKNRQSFYSWKMDETYIKIKGRWHYLYRAIDADGLTL
DIWLRKKRDTQAAYAFLKRLHKQFGEPKAIVTDKAPSLGSAFRKLQSVGLYTKTEHRTVKYLNNLIEQDHQPIKRRNKFCQSLRTASSTIKGIKTLRGIY
KKNRRNGTLFGFSVSTEIKVLMGITA

 

Blast result :
Comments
-
References
1] Schäfer, A., Jahns, A., Geis, A., and Teuber, M. (1991) FEMS Microbiol. Lett. 80, 311-318.