ISS1RS

  • Family IS6
  • Group
MGE type ISRelated element(s) :
Isoform ISS1SSynonym(s) RS1, RS2
Accession numberTranspositionOriginHost
X60594 Y Lactococcus lactis
Lactococcus plantarum 1137
Lactococcus lactis subsp. cremoris MG1363
Lactococcus lactis subsp. lactis MG1363
Lactococcus lactis subsp. lactis CNRZ270 plasmid pUCL22
Lactococcus casei 1095
Lactococcus lactis subsp. cremoris C10
Lactococcus lactis subsp. cremoris C39
Lactococcus lactis subsp. cremoris C85
Lactococcus lactis subsp. lactis 1023
Lactococcus lactis subsp. lactis L26
Lactococcus lactis subsp. lactis ML3
Lactococcus lactis subsp. lactis biovar diacetylactis D44
DNA section
IS Length : 808 bp

Ends


IR Length : 18

IRL : GGTTCTGTTGCAAAGTTTTCTGATAAGTCTATTTTAGTGTAAAATGAATA
IRR : GGTTCTGTTGCAAAGTTTAAAAATCAAATACAAGGTTTATAATCCTTCTT

Insertion site


Left flankDirect repeatRight flankDR Length
NNNNCTATCAAGAGAATGTCATTGNNNN8

DNA sequence

GGTTCTGTTGCAAAGTTTTCTGATAAGTCTATTTTAGTGTAAAATGAATAAAAATGACAGCGAGGATATATCAATGAACTATTTTAAAGGTAAACAATTT
CAAAAAGATGTGATTATTGTCGCTGTTGGTTATTATCTACGTTACAATCTAAGCTATCGTGAAATTCAAGAACTCCTTTATGATCGTGGAATTAATGTTT
GTCACACAACTATTTATCGTTGGGTACAAGAATACAGTAAAGTCCTCTATCATCTCTGGAAAAAGAAAAATAGACAGTCCTTCTATTCGTGGAAAATGGA
TGAAACTTATATCAAAATCAAAGGTCGTTGGCATTATCTCTATCGTGCAATTGATGCGGATGGATTGACTTTAGACATCTGGCTACGCAAGAAACGGAAT
ACTCAAGCTGCTTATGCGTTCTTGAAACGACTACATAAACAGTTTGGTCAACCAAGAGTAATTGTCACGGATAAAGCGCCCTCTATTGGTTCTGCATTTA
GAAAGTTACAGAGTAACGGTTTATATACTAAGACAGAGCATCGAACCGTGAAGTATCTCAATAACCTCATTGAGCAAGACCATCGACCAATCAAACGACG
CAATAAATTTTATCGAAGTCTACAAACTGCCTCAACCACGATTAAGGGCATGGAAACAATTCGAGGAATATACAAAAAGAACCGAAGAAATGGAACGCTC
TTCGGATTTTCGGTATCTACTGAGATTAAGGTCTTAATGGGAATATTAGCTTAAGAACAAGAAGGATTATAAACCTTGTATTTGATTTTTAAACTTTGCA
ACAGAACC
Protein section
ORF number : 1

 

ORF 1
LengthBeginEndStrandFusion ORF
681 bp226 aa74754+No
ORF function : Transposase
Chemistry : DDE

ORF sequence :

MNKNDSEDISMNYFKGKQFQKDVIIVAVGYYLRYNLSYREIQELLYDRGINVCHTTIYRWVQEYSKVLYHLWKKKNRQSFYSWKMDETYIKIKGRWHYLY
RAIDADGLTLDIWLRKKRNTQAAYAFLKRLHKQFGQPRVIVTDKAPSIGSAFRKLQSNGLYTKTEHRTVKYLNNLIEQDHRPIKRRNKFYRSLQTASTTI
KGMETIRGIYKKNRRNGTLFGFSVSTEIKVLMGILA

 

Blast result :
Comments
ISS1RS differs from ISS1T by 1 nt (1 aa). The distribution of ISS1RS among Lactococcus species parallels that of the lactose plasmid (Bounaix et al., 1996). ISS1RS is present in one copy in the 2,560 kb chromosome of the Lactococcus lactis subsp. cremoris reference strain MG1363 (Le Bourgeois et al., 1995).
References
1] Novel, M., Huang, D.C., and Novel, G. (1988) Biochimie 70, 543-551.
2] Huang, D.C. (1990) Ph.D. Thesis, Université de Caen, France.
3] Le Bourgeois, P., Lautier, M., Mata, M., and Ritzenthaler, P. (1992) Gene 111, 109- 114.
4] Huang, D.C., Novel, M., Huang, X.F., and Novel, G. (1992) Gene 118, 39-46.
5] Le Bourgeois, P., Lautier, M., van den Berghe, L., Gasson, M.J., Ritzenthaler, P. (1995) J. Bacteriol. 177, 2840-2850.
6] Bounaix, S., Benachour, A., and Novel, G. (1996) Appl. Environ. Microbiol. 62, 1112-1115.